BLASTX nr result
ID: Mentha24_contig00030560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00030560 (457 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36306.1| hypothetical protein MIMGU_mgv1a014376mg [Mimulus... 77 2e-12 >gb|EYU36306.1| hypothetical protein MIMGU_mgv1a014376mg [Mimulus guttatus] Length = 191 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/66 (59%), Positives = 47/66 (71%) Frame = +2 Query: 11 KEHKILEDKVKSDALEHKAGPLESTEVPGRGSQEVPPKYVESQKKSSVWNDLKSFANGIL 190 ++ I EDKVK D L+ K+ P ES EV GR EVP K +E QKKSS+W +LKSFAN IL Sbjct: 126 RKETIHEDKVKFDGLQPKSEPQESVEVSGRELDEVPSKELEPQKKSSMWKNLKSFANEIL 185 Query: 191 SIWKRS 208 IW+RS Sbjct: 186 DIWRRS 191