BLASTX nr result
ID: Mentha24_contig00030488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00030488 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL91979.1|AF483190_1 isopentenyl pyrophosphate isomerase IDI... 70 2e-10 gb|EYU39709.1| hypothetical protein MIMGU_mgv1a010795mg [Mimulus... 69 7e-10 gb|AEV89961.1| isopentenyl-diphosphate isomerase [Humulus lupulus] 69 7e-10 dbj|BAF98287.1| isopentenyl-diphosphate Delta-isomerase [Hevea b... 69 7e-10 dbj|BAE92732.1| isopentenyl pyrophosphate isomerase [Gentiana lu... 69 7e-10 ref|XP_004139102.1| PREDICTED: isopentenyl-diphosphate Delta-iso... 69 9e-10 gb|AEM42977.1| isopentenyl diphosphate isomerase [Siraitia grosv... 69 9e-10 dbj|BAB40974.1| isopentenyl diphosphate isomerase 2 [Nicotiana t... 68 1e-09 gb|ABV08818.1| isopentenyl pyrophosphate isomerase [Salvia milti... 68 1e-09 ref|NP_001234853.1| isopentenyl diphosphate isomerase [Solanum l... 68 1e-09 gb|AFS28682.1| putative isopentenyl diphosphate isomerase, parti... 68 1e-09 gb|AFS28681.1| putative isopentenyl diphosphate isomerase, parti... 68 1e-09 gb|AEV89962.1| isopentenyl-diphosphate isomerase [Humulus lupulus] 68 1e-09 gb|AEP17009.1| isopentenyl diphosphate isomerase II(IPI2) [Vitis... 68 1e-09 gb|AEP17008.1| isopentenyl diphosphate isomerase II(IPI2) [Vitis... 68 1e-09 gb|ABW06959.1| isopentenyl pyrophosphate isomerase [Corylus avel... 68 1e-09 emb|CBI17623.3| unnamed protein product [Vitis vinifera] 68 1e-09 ref|XP_002277935.1| PREDICTED: isopentenyl-diphosphate Delta-iso... 68 1e-09 ref|XP_007029312.1| Isopentenyl pyrophosphate:dimethylallyl pyro... 67 2e-09 gb|ADZ57065.1| isopentenyl pyrophosphate:dimethylallyl pyrophosp... 67 2e-09 >gb|AAL91979.1|AF483190_1 isopentenyl pyrophosphate isomerase IDI2 [Melaleuca alternifolia] Length = 235 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT Sbjct: 205 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 235 >gb|EYU39709.1| hypothetical protein MIMGU_mgv1a010795mg [Mimulus guttatus] Length = 301 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGTL+EAADMKTIHKLT Sbjct: 271 VVDNFLFKWWDHVEKGTLEEAADMKTIHKLT 301 >gb|AEV89961.1| isopentenyl-diphosphate isomerase [Humulus lupulus] Length = 321 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGTLKE ADMKTIHKLT Sbjct: 291 VVDNFLFKWWDHVEKGTLKEVADMKTIHKLT 321 >dbj|BAF98287.1| isopentenyl-diphosphate Delta-isomerase [Hevea brasiliensis] Length = 234 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWW+HVEKGTLKEAADMKTIHKLT Sbjct: 204 VVDNFLFKWWEHVEKGTLKEAADMKTIHKLT 234 >dbj|BAE92732.1| isopentenyl pyrophosphate isomerase [Gentiana lutea] Length = 235 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGTL+EAADMKTIHKLT Sbjct: 205 VVDNFLFKWWDHVEKGTLQEAADMKTIHKLT 235 >ref|XP_004139102.1| PREDICTED: isopentenyl-diphosphate Delta-isomerase I-like [Cucumis sativus] gi|449485345|ref|XP_004157140.1| PREDICTED: isopentenyl-diphosphate Delta-isomerase I-like [Cucumis sativus] Length = 235 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLF WWDHVEKGTLKEAADMKTIHKLT Sbjct: 205 VVDNFLFSWWDHVEKGTLKEAADMKTIHKLT 235 >gb|AEM42977.1| isopentenyl diphosphate isomerase [Siraitia grosvenorii] Length = 279 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLF WWDHVEKGTLKEAADMKTIHKLT Sbjct: 249 VVDNFLFNWWDHVEKGTLKEAADMKTIHKLT 279 >dbj|BAB40974.1| isopentenyl diphosphate isomerase 2 [Nicotiana tabacum] Length = 235 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGT++EAADMKTIHKLT Sbjct: 205 VVDNFLFKWWDHVEKGTIQEAADMKTIHKLT 235 >gb|ABV08818.1| isopentenyl pyrophosphate isomerase [Salvia miltiorrhiza] Length = 305 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGT+KEA DMKTIHKLT Sbjct: 275 VVDNFLFKWWDHVEKGTIKEAVDMKTIHKLT 305 >ref|NP_001234853.1| isopentenyl diphosphate isomerase [Solanum lycopersicum] gi|160966279|gb|ABX55779.1| isopentenyl diphosphate isomerase [Solanum lycopersicum] Length = 235 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGT++EAADMKTIHKLT Sbjct: 205 VVDNFLFKWWDHVEKGTIQEAADMKTIHKLT 235 >gb|AFS28682.1| putative isopentenyl diphosphate isomerase, partial [Olea europaea] Length = 222 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGT+ EAADMKTIHKLT Sbjct: 192 VVDNFLFKWWDHVEKGTISEAADMKTIHKLT 222 >gb|AFS28681.1| putative isopentenyl diphosphate isomerase, partial [Olea europaea] Length = 222 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGT+ EAADMKTIHKLT Sbjct: 192 VVDNFLFKWWDHVEKGTISEAADMKTIHKLT 222 >gb|AEV89962.1| isopentenyl-diphosphate isomerase [Humulus lupulus] Length = 321 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGTLK+ ADMKTIHKLT Sbjct: 291 VVDNFLFKWWDHVEKGTLKDVADMKTIHKLT 321 >gb|AEP17009.1| isopentenyl diphosphate isomerase II(IPI2) [Vitis vinifera] Length = 290 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGTL EAADMKTIHKLT Sbjct: 260 VVDNFLFKWWDHVEKGTLLEAADMKTIHKLT 290 >gb|AEP17008.1| isopentenyl diphosphate isomerase II(IPI2) [Vitis vinifera] Length = 290 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGTL EAADMKTIHKLT Sbjct: 260 VVDNFLFKWWDHVEKGTLLEAADMKTIHKLT 290 >gb|ABW06959.1| isopentenyl pyrophosphate isomerase [Corylus avellana] Length = 296 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWD+VEKGTLKEAADMKTIHKLT Sbjct: 266 VVDNFLFKWWDNVEKGTLKEAADMKTIHKLT 296 >emb|CBI17623.3| unnamed protein product [Vitis vinifera] Length = 226 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGTL EAADMKTIHKLT Sbjct: 196 VVDNFLFKWWDHVEKGTLLEAADMKTIHKLT 226 >ref|XP_002277935.1| PREDICTED: isopentenyl-diphosphate Delta-isomerase I-like [Vitis vinifera] Length = 293 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGTL EAADMKTIHKLT Sbjct: 263 VVDNFLFKWWDHVEKGTLLEAADMKTIHKLT 293 >ref|XP_007029312.1| Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase 2 [Theobroma cacao] gi|508717917|gb|EOY09814.1| Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase 2 [Theobroma cacao] Length = 301 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGTLKEA DM+TIHKLT Sbjct: 271 VVDNFLFKWWDHVEKGTLKEATDMETIHKLT 301 >gb|ADZ57065.1| isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Mentha x piperita] Length = 298 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 401 VVDNFLFKWWDHVEKGTLKEAADMKTIHKLT 309 VVDNFLFKWWDHVEKGTL +AADMKTIHKLT Sbjct: 267 VVDNFLFKWWDHVEKGTLNQAADMKTIHKLT 297