BLASTX nr result
ID: Mentha24_contig00030363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00030363 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21510.1| hypothetical protein MIMGU_mgv1a012762mg [Mimulus... 65 1e-08 >gb|EYU21510.1| hypothetical protein MIMGU_mgv1a012762mg [Mimulus guttatus] Length = 241 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +3 Query: 3 HDSSRCTCVFAVRWDHDNLEGKVTAEKLCYRPNKSAPKESE 125 HDSSRCTC+F VR+DHDN+EGKV KLC RP KS K +E Sbjct: 184 HDSSRCTCLFVVRYDHDNVEGKVPLHKLCCRPAKSVSKGNE 224