BLASTX nr result
ID: Mentha24_contig00030333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00030333 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41672.1| hypothetical protein MIMGU_mgv1a008905mg [Mimulus... 60 3e-07 gb|EPS58056.1| hypothetical protein M569_16759 [Genlisea aurea] 55 8e-06 >gb|EYU41672.1| hypothetical protein MIMGU_mgv1a008905mg [Mimulus guttatus] Length = 359 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 HPYASYFDENMLATKLFAQKAENERAMAKN 92 HPYASYFD+NM+ATKLFAQK ENERAM+KN Sbjct: 330 HPYASYFDDNMIATKLFAQKVENERAMSKN 359 >gb|EPS58056.1| hypothetical protein M569_16759 [Genlisea aurea] Length = 357 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 3 HPYASYFDENMLATKLFAQKAENERAMAKN 92 HPYA+YF++NM+ATKLFAQK ENERAMAK+ Sbjct: 328 HPYANYFNDNMVATKLFAQKIENERAMAKS 357