BLASTX nr result
ID: Mentha24_contig00030247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00030247 (435 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45982.1| hypothetical protein MIMGU_mgv1a010545mg [Mimulus... 70 3e-10 >gb|EYU45982.1| hypothetical protein MIMGU_mgv1a010545mg [Mimulus guttatus] Length = 309 Score = 70.1 bits (170), Expect = 3e-10 Identities = 40/76 (52%), Positives = 47/76 (61%) Frame = -3 Query: 433 REAEKLRSELASAEKRXXXXXXXXXXXANPGSGYAIHQRTLEPGFGENSLSDHHDVHQGN 254 REAEKLRSELA+AE+R ANPG+ YA HQ +PG+G N L + H V+Q Sbjct: 208 REAEKLRSELANAEQRAMAAAAAAASAANPGAVYATHQINYDPGYGGNPLYNPHAVNQVT 267 Query: 253 FDAGMNNAYGGGPNIP 206 FDAG N YG G IP Sbjct: 268 FDAGAN--YGLGAGIP 281