BLASTX nr result
ID: Mentha24_contig00030015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00030015 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37440.1| hypothetical protein MIMGU_mgv11b003028mg [Mimulu... 67 3e-09 ref|XP_007198899.1| hypothetical protein PRUPE_ppa003025mg [Prun... 60 3e-07 >gb|EYU37440.1| hypothetical protein MIMGU_mgv11b003028mg [Mimulus guttatus] Length = 571 Score = 66.6 bits (161), Expect = 3e-09 Identities = 41/87 (47%), Positives = 54/87 (62%), Gaps = 2/87 (2%) Frame = -2 Query: 336 EVVAASSIKEVSGKQSNGKREAEISTEEMDSTPAKKVATEADFWRPNECD--SNAETIEG 163 EVV +S K + GKREAEI T EMD T K++ A+ + D S E +G Sbjct: 485 EVVTSSDNKGDCVVNNLGKREAEICTAEMDDTRVKRLEIVAEDCVMQDQDDVSEEEGTKG 544 Query: 162 YLMIDGVWKKVEEEELLAIASAVKLMI 82 L+IDGVWKKV EEEL AIASA+++++ Sbjct: 545 CLVIDGVWKKVGEEELSAIASAIRVLV 571 >ref|XP_007198899.1| hypothetical protein PRUPE_ppa003025mg [Prunus persica] gi|462394194|gb|EMJ00098.1| hypothetical protein PRUPE_ppa003025mg [Prunus persica] Length = 611 Score = 60.1 bits (144), Expect = 3e-07 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = -2 Query: 294 QSNGKREAEISTEEMDSTPAKKVA-TEADFWRPNECDSNAETIEGYLMIDGVWKKVEEEE 118 Q +GKREA +D+ KK+ TE +E S+ E + G+LMIDGVWK+V EEE Sbjct: 540 QCSGKREASSDLHLLDNQCVKKLRETEDGCVSDSEHVSSIEDVSGHLMIDGVWKRVGEEE 599 Query: 117 LLAIASAVKLMI 82 LLAI SA++++I Sbjct: 600 LLAIKSALRILI 611