BLASTX nr result
ID: Mentha24_contig00029993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00029993 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44416.1| hypothetical protein MIMGU_mgv1a011890mg [Mimulus... 59 7e-07 >gb|EYU44416.1| hypothetical protein MIMGU_mgv1a011890mg [Mimulus guttatus] Length = 267 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +2 Query: 2 WGMRVPLNCFVGLLTISPALQIRPKEILLHEENLHAWPVY 121 WGMRVPL+ +GLLTISPALQI+PK +LL + WP+Y Sbjct: 228 WGMRVPLDSIIGLLTISPALQIQPKGMLLPDHAYQGWPIY 267