BLASTX nr result
ID: Mentha24_contig00029944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00029944 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40672.1| hypothetical protein MIMGU_mgv1a007852mg [Mimulus... 60 3e-07 >gb|EYU40672.1| hypothetical protein MIMGU_mgv1a007852mg [Mimulus guttatus] Length = 393 Score = 60.1 bits (144), Expect = 3e-07 Identities = 39/83 (46%), Positives = 45/83 (54%), Gaps = 11/83 (13%) Frame = +2 Query: 98 SPSQPQLVPA-TNSAQSESAP----------KRGGIFNSLPPPKLSLFNSLPPPKSQSFP 244 SP Q ++VPA T ++ SE+ K GGIFNSLPPPK SLFNSLPPPK QS Sbjct: 17 SPVQRRIVPARTVNSVSEAGKDGDFLANPTSKHGGIFNSLPPPKSSLFNSLPPPKPQS-- 74 Query: 245 NPKPQSEAEHGLDEKFTENPKPK 313 DE+ E KPK Sbjct: 75 ----GFAKNRDFDEQIVEKSKPK 93