BLASTX nr result
ID: Mentha24_contig00029666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00029666 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46829.1| hypothetical protein MIMGU_mgv1a016645mg [Mimulus... 70 5e-11 >gb|EYU46829.1| hypothetical protein MIMGU_mgv1a016645mg [Mimulus guttatus] Length = 113 Score = 69.7 bits (169), Expect(2) = 5e-11 Identities = 34/59 (57%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = +3 Query: 111 MFVTAFFFLVLILQGLGSSAGSNLTITGAPQPQP-APETRGLSPVQFYRTVMSDEVLPP 284 M +T FFLVLI QGLGSS+ SN+T+ APQP P GL+PVQFY+TV+SD+ P Sbjct: 46 MVITVLFFLVLIFQGLGSSSSSNVTVADAPQPAPDTTAAAGLTPVQFYKTVLSDDGAAP 104 Score = 23.1 bits (48), Expect(2) = 5e-11 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +2 Query: 272 GAAPTFLPPK 301 GAAP+F+PPK Sbjct: 101 GAAPSFVPPK 110