BLASTX nr result
ID: Mentha24_contig00029448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00029448 (629 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33536.1| hypothetical protein MIMGU_mgv1a014145mg [Mimulus... 62 1e-07 >gb|EYU33536.1| hypothetical protein MIMGU_mgv1a014145mg [Mimulus guttatus] Length = 199 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +3 Query: 3 GLESVSVPRPPMAGDGFGGDPMMEDWVKQSEELVASQ 113 GLESV+ PRPP+ GD FGGD MMEDWVKQ EEL SQ Sbjct: 43 GLESVTGPRPPVGGDSFGGDAMMEDWVKQFEELAGSQ 79