BLASTX nr result
ID: Mentha24_contig00029415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00029415 (460 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGL11918.1| DIV and RAD interacting factor 1 [Antirrhinum majus] 57 3e-06 ref|XP_004486880.1| PREDICTED: uncharacterized protein LOC101498... 56 6e-06 ref|XP_006407822.1| hypothetical protein EUTSA_v10021333mg [Eutr... 55 8e-06 >gb|AGL11918.1| DIV and RAD interacting factor 1 [Antirrhinum majus] Length = 251 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +3 Query: 3 ISMLNDSSDLPEVMKLMPPLPVKLNEELVNCVFNRAPLPKKS 128 +S+LND +DLPE+MK MPPLPVKLNEEL + + + L KKS Sbjct: 210 LSILNDFNDLPEIMKQMPPLPVKLNEELASSILPQTSLAKKS 251 >ref|XP_004486880.1| PREDICTED: uncharacterized protein LOC101498979 [Cicer arietinum] Length = 237 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = +3 Query: 3 ISMLNDSSDLPEVMKLMPPLPVKLNEELVNCVFNRAPLPKKS 128 + ++N+ +D PEVMK MPPLPVK+NEEL N + R PLP +S Sbjct: 196 LRIMNELNDSPEVMKQMPPLPVKMNEELANSILPRTPLPPQS 237 >ref|XP_006407822.1| hypothetical protein EUTSA_v10021333mg [Eutrema salsugineum] gi|557108968|gb|ESQ49275.1| hypothetical protein EUTSA_v10021333mg [Eutrema salsugineum] Length = 267 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +3 Query: 3 ISMLNDSSDLPEVMKLMPPLPVKLNEELVNCVFNRAPLPKKS 128 +++LND +D+PEVMK MPPLPVK+NEEL N + R P KS Sbjct: 226 LAILNDLNDMPEVMKQMPPLPVKVNEELANSILPRPPHQMKS 267