BLASTX nr result
ID: Mentha24_contig00029256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00029256 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGJ03149.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 72 1e-10 gb|AFQ95412.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 72 1e-10 gb|AEZ55669.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 72 1e-10 ref|XP_006856134.1| hypothetical protein AMTR_s00059p00159100 [A... 69 5e-10 gb|AFB70984.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 69 5e-10 gb|ACC54561.1| putative 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho... 69 5e-10 gb|ABO26588.1| type 2 1-hydroxy-2-methyl-2-(E)-butenyl-4-phospha... 69 5e-10 ref|XP_006650541.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 69 9e-10 gb|EEC76125.1| hypothetical protein OsI_13396 [Oryza sativa Indi... 69 9e-10 gb|EAZ28477.1| hypothetical protein OsJ_12459 [Oryza sativa Japo... 69 9e-10 ref|NP_001051167.1| Os03g0731900 [Oryza sativa Japonica Group] g... 69 9e-10 gb|EMS62455.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 68 1e-09 emb|CBI32545.3| unnamed protein product [Vitis vinifera] 68 1e-09 gb|ABB78089.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 68 1e-09 ref|XP_002284659.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diph... 68 1e-09 gb|ABM89226.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductas... 68 1e-09 gb|ABU44490.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate re... 67 2e-09 gb|EYU37753.1| hypothetical protein MIMGU_mgv1a005937mg [Mimulus... 67 3e-09 gb|EYU37751.1| hypothetical protein MIMGU_mgv1a026562mg [Mimulus... 67 3e-09 gb|ACY66876.1| P10Sh086H20 [Saccharum hybrid cultivar R570] 67 3e-09 >gb|AGJ03149.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase [Salvia miltiorrhiza f. alba] Length = 463 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVLLSA 300 W+PEGP+TIGVTSGASTPD VVQDVLEK+F++K EVL SA Sbjct: 423 WMPEGPVTIGVTSGASTPDKVVQDVLEKVFEMKQAEVLQSA 463 >gb|AFQ95412.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Salvia miltiorrhiza] Length = 463 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVLLSA 300 W+PEGP+TIGVTSGASTPD VVQDVLEK+F++K EVL SA Sbjct: 423 WMPEGPVTIGVTSGASTPDKVVQDVLEKVFEMKQAEVLQSA 463 >gb|AEZ55669.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 1 [Salvia miltiorrhiza] Length = 463 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVLLSA 300 W+PEGP+TIGVTSGASTPD VVQDVLEK+F++K EVL SA Sbjct: 423 WMPEGPVTIGVTSGASTPDKVVQDVLEKVFEMKQAEVLQSA 463 >ref|XP_006856134.1| hypothetical protein AMTR_s00059p00159100 [Amborella trichopoda] gi|548859993|gb|ERN17601.1| hypothetical protein AMTR_s00059p00159100 [Amborella trichopoda] Length = 468 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVL 309 WLPEGPITIGVTSGASTPD VV+DVL K+FD+K EE+L Sbjct: 426 WLPEGPITIGVTSGASTPDKVVEDVLTKVFDIKREELL 463 >gb|AFB70984.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, partial [Mitragyna speciosa] Length = 96 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVL 309 WLPEGPITIGVTSGASTPD VV+DVL K+FDLK EE L Sbjct: 56 WLPEGPITIGVTSGASTPDKVVEDVLVKVFDLKREEAL 93 >gb|ACC54561.1| putative 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase type 2 [Pinus densiflora] Length = 487 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVLLSA 300 WLPEGPITIG+TSGASTPD VV+D L+KIF++K EEVL +A Sbjct: 447 WLPEGPITIGITSGASTPDKVVEDALKKIFEIKREEVLQAA 487 >gb|ABO26588.1| type 2 1-hydroxy-2-methyl-2-(E)-butenyl-4-phosphate reductase [Pinus taeda] Length = 487 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVLLSA 300 WLPEGPITIG+TSGASTPD VV+D L+KIF++K EEVL +A Sbjct: 447 WLPEGPITIGITSGASTPDKVVEDALKKIFEIKREEVLQAA 487 >ref|XP_006650541.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic-like [Oryza brachyantha] Length = 459 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVLLSA 300 WLPEGPITIGVTSGASTPD VV+D L+K+F++K +EVL +A Sbjct: 419 WLPEGPITIGVTSGASTPDKVVEDALQKVFEIKRQEVLQAA 459 >gb|EEC76125.1| hypothetical protein OsI_13396 [Oryza sativa Indica Group] Length = 459 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVLLSA 300 WLPEGPITIGVTSGASTPD VV+D L+K+F++K +EVL +A Sbjct: 419 WLPEGPITIGVTSGASTPDKVVEDALQKVFEIKRQEVLQAA 459 >gb|EAZ28477.1| hypothetical protein OsJ_12459 [Oryza sativa Japonica Group] Length = 599 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVLLSA 300 WLPEGPITIGVTSGASTPD VV+D L+K+F++K +EVL +A Sbjct: 559 WLPEGPITIGVTSGASTPDKVVEDALQKVFEIKRQEVLQAA 599 >ref|NP_001051167.1| Os03g0731900 [Oryza sativa Japonica Group] gi|75254572|sp|Q6AVG6.1|ISPH_ORYSJ RecName: Full=4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic; Flags: Precursor gi|50540738|gb|AAT77894.1| putative LytB protein [Oryza sativa Japonica Group] gi|108710907|gb|ABF98702.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, putative, expressed [Oryza sativa Japonica Group] gi|113549638|dbj|BAF13081.1| Os03g0731900 [Oryza sativa Japonica Group] gi|215694051|dbj|BAG89250.1| unnamed protein product [Oryza sativa Japonica Group] gi|215768321|dbj|BAH00550.1| unnamed protein product [Oryza sativa Japonica Group] Length = 459 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVLLSA 300 WLPEGPITIGVTSGASTPD VV+D L+K+F++K +EVL +A Sbjct: 419 WLPEGPITIGVTSGASTPDKVVEDALQKVFEIKRQEVLQAA 459 >gb|EMS62455.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Triticum urartu] Length = 439 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVL 309 WLPEGPITIGVTSGASTPD VV+D L K+FD+K +EVL Sbjct: 399 WLPEGPITIGVTSGASTPDKVVEDTLHKVFDIKRQEVL 436 >emb|CBI32545.3| unnamed protein product [Vitis vinifera] Length = 380 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVL 309 WLPEGPITIGVTSGASTPD VV+DVL K+FD+K EE L Sbjct: 340 WLPEGPITIGVTSGASTPDKVVEDVLIKVFDIKREEAL 377 >gb|ABB78089.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase type 2 [Ginkgo biloba] Length = 482 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVL 309 WLPEGPITIGVTSGASTPD V+DVL K+F++K EEVL Sbjct: 442 WLPEGPITIGVTSGASTPDKAVEDVLRKVFEIKQEEVL 479 >ref|XP_002284659.1| PREDICTED: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Vitis vinifera] Length = 465 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVL 309 WLPEGPITIGVTSGASTPD VV+DVL K+FD+K EE L Sbjct: 425 WLPEGPITIGVTSGASTPDKVVEDVLIKVFDIKREEAL 462 >gb|ABM89226.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Picrorhiza kurrooa] Length = 462 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVL 309 WLPEGPITIGVTSGASTPD V+DVL KIFD+K EE+L Sbjct: 422 WLPEGPITIGVTSGASTPDKAVEDVLTKIFDIKREELL 459 >gb|ABU44490.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase [Taxus x media] Length = 474 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVL 309 WLPEGPITIG+TSGASTPD VV+DVL K+F++K EE L Sbjct: 434 WLPEGPITIGITSGASTPDKVVEDVLRKVFEIKREEAL 471 >gb|EYU37753.1| hypothetical protein MIMGU_mgv1a005937mg [Mimulus guttatus] Length = 464 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVL 309 WLPEGPITIG+TSGASTPD VV+DVL K+FD+K +E L Sbjct: 424 WLPEGPITIGITSGASTPDKVVEDVLVKVFDIKRDEAL 461 >gb|EYU37751.1| hypothetical protein MIMGU_mgv1a026562mg [Mimulus guttatus] Length = 455 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVL 309 WLPEGPITIG+TSGASTPD VV+DVL K+FD+K +E L Sbjct: 415 WLPEGPITIGITSGASTPDKVVEDVLVKVFDIKRDEAL 452 >gb|ACY66876.1| P10Sh086H20 [Saccharum hybrid cultivar R570] Length = 467 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -3 Query: 422 WLPEGPITIGVTSGASTPDNVVQDVLEKIFDLKSEEVL 309 WLPEGPITIGVTSGASTPD VV+D L+K+F++K +E+L Sbjct: 427 WLPEGPITIGVTSGASTPDKVVEDALQKVFEIKRQEIL 464