BLASTX nr result
ID: Mentha24_contig00029016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00029016 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002968029.1| hypothetical protein SELMODRAFT_88496 [Selag... 138 7e-31 ref|XP_002992614.1| hypothetical protein SELMODRAFT_135624 [Sela... 138 7e-31 ref|XP_007049082.1| Methionine aminopeptidase 2B [Theobroma caca... 138 9e-31 ref|XP_007218025.1| hypothetical protein PRUPE_ppa005954mg [Prun... 138 9e-31 gb|EYU37051.1| hypothetical protein MIMGU_mgv1a006764mg [Mimulus... 137 2e-30 gb|ABB91775.1| methionine aminopeptidase 2 [Ananas comosus] 137 2e-30 ref|XP_006478515.1| PREDICTED: methionine aminopeptidase 2B-like... 137 2e-30 ref|XP_006441966.1| hypothetical protein CICLE_v10020270mg [Citr... 137 2e-30 ref|XP_002270461.1| PREDICTED: methionine aminopeptidase 2B-like... 137 2e-30 emb|CBI38751.3| unnamed protein product [Vitis vinifera] 137 2e-30 gb|EXB55195.1| Methionine aminopeptidase 2B [Morus notabilis] 136 3e-30 ref|XP_004309911.1| PREDICTED: methionine aminopeptidase 2B-like... 136 3e-30 ref|XP_004228613.1| PREDICTED: methionine aminopeptidase 2B-like... 136 3e-30 ref|XP_002529218.1| methionine aminopeptidase, putative [Ricinus... 136 3e-30 ref|XP_002305888.1| METHIONINE AMINOPEPTIDASE 2A family protein ... 136 3e-30 ref|XP_007142586.1| hypothetical protein PHAVU_007G000100g [Phas... 135 4e-30 ref|XP_003555103.1| PREDICTED: methionine aminopeptidase 2B-like... 135 4e-30 ref|XP_006664225.1| PREDICTED: methionine aminopeptidase 2B-like... 135 6e-30 ref|XP_006579793.1| PREDICTED: methionine aminopeptidase 2B-like... 135 6e-30 ref|XP_006579792.1| PREDICTED: methionine aminopeptidase 2B-like... 135 6e-30 >ref|XP_002968029.1| hypothetical protein SELMODRAFT_88496 [Selaginella moellendorffii] gi|300164767|gb|EFJ31376.1| hypothetical protein SELMODRAFT_88496 [Selaginella moellendorffii] Length = 376 Score = 138 bits (348), Expect = 7e-31 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCD+KGSYVAQFEHT+LLRPTCKEV+S Sbjct: 312 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDIKGSYVAQFEHTVLLRPTCKEVLS 371 Query: 238 RGDDY 224 RGDDY Sbjct: 372 RGDDY 376 >ref|XP_002992614.1| hypothetical protein SELMODRAFT_135624 [Selaginella moellendorffii] gi|300139578|gb|EFJ06316.1| hypothetical protein SELMODRAFT_135624 [Selaginella moellendorffii] Length = 376 Score = 138 bits (348), Expect = 7e-31 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCD+KGSYVAQFEHT+LLRPTCKEV+S Sbjct: 312 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDIKGSYVAQFEHTVLLRPTCKEVLS 371 Query: 238 RGDDY 224 RGDDY Sbjct: 372 RGDDY 376 >ref|XP_007049082.1| Methionine aminopeptidase 2B [Theobroma cacao] gi|508701343|gb|EOX93239.1| Methionine aminopeptidase 2B [Theobroma cacao] Length = 514 Score = 138 bits (347), Expect = 9e-31 Identities = 63/65 (96%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 450 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDVKGSYVSQFEHTILLRPTCKEVIS 509 Query: 238 RGDDY 224 RGDDY Sbjct: 510 RGDDY 514 >ref|XP_007218025.1| hypothetical protein PRUPE_ppa005954mg [Prunus persica] gi|462414487|gb|EMJ19224.1| hypothetical protein PRUPE_ppa005954mg [Prunus persica] Length = 435 Score = 138 bits (347), Expect = 9e-31 Identities = 63/65 (96%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 371 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDVKGSYVSQFEHTILLRPTCKEVIS 430 Query: 238 RGDDY 224 RGDDY Sbjct: 431 RGDDY 435 >gb|EYU37051.1| hypothetical protein MIMGU_mgv1a006764mg [Mimulus guttatus] Length = 432 Score = 137 bits (345), Expect = 2e-30 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDR+GETKYLMALKNLCDAGIVQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 368 AFCRRYLDRIGETKYLMALKNLCDAGIVQPYPPLCDVKGSYVSQFEHTILLRPTCKEVIS 427 Query: 238 RGDDY 224 RGDDY Sbjct: 428 RGDDY 432 >gb|ABB91775.1| methionine aminopeptidase 2 [Ananas comosus] Length = 460 Score = 137 bits (345), Expect = 2e-30 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDR+GETKYLMALKNLCDAGIVQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 396 AFCRRYLDRIGETKYLMALKNLCDAGIVQPYPPLCDVKGSYVSQFEHTILLRPTCKEVIS 455 Query: 238 RGDDY 224 RGDDY Sbjct: 456 RGDDY 460 >ref|XP_006478515.1| PREDICTED: methionine aminopeptidase 2B-like [Citrus sinensis] Length = 425 Score = 137 bits (344), Expect = 2e-30 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCD GIVQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 361 AFCRRYLDRLGETKYLMALKNLCDTGIVQPYPPLCDIKGSYVSQFEHTILLRPTCKEVIS 420 Query: 238 RGDDY 224 RGDDY Sbjct: 421 RGDDY 425 >ref|XP_006441966.1| hypothetical protein CICLE_v10020270mg [Citrus clementina] gi|557544228|gb|ESR55206.1| hypothetical protein CICLE_v10020270mg [Citrus clementina] Length = 425 Score = 137 bits (344), Expect = 2e-30 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCD GIVQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 361 AFCRRYLDRLGETKYLMALKNLCDTGIVQPYPPLCDIKGSYVSQFEHTILLRPTCKEVIS 420 Query: 238 RGDDY 224 RGDDY Sbjct: 421 RGDDY 425 >ref|XP_002270461.1| PREDICTED: methionine aminopeptidase 2B-like [Vitis vinifera] Length = 421 Score = 137 bits (344), Expect = 2e-30 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCD+GIVQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 357 AFCRRYLDRLGETKYLMALKNLCDSGIVQPYPPLCDVKGSYVSQFEHTILLRPTCKEVIS 416 Query: 238 RGDDY 224 RGDDY Sbjct: 417 RGDDY 421 >emb|CBI38751.3| unnamed protein product [Vitis vinifera] Length = 420 Score = 137 bits (344), Expect = 2e-30 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCD+GIVQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 356 AFCRRYLDRLGETKYLMALKNLCDSGIVQPYPPLCDVKGSYVSQFEHTILLRPTCKEVIS 415 Query: 238 RGDDY 224 RGDDY Sbjct: 416 RGDDY 420 >gb|EXB55195.1| Methionine aminopeptidase 2B [Morus notabilis] Length = 395 Score = 136 bits (343), Expect = 3e-30 Identities = 62/65 (95%), Positives = 64/65 (98%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCD GIVQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 331 AFCRRYLDRLGETKYLMALKNLCDTGIVQPYPPLCDVKGSYVSQFEHTILLRPTCKEVIS 390 Query: 238 RGDDY 224 RGDDY Sbjct: 391 RGDDY 395 >ref|XP_004309911.1| PREDICTED: methionine aminopeptidase 2B-like [Fragaria vesca subsp. vesca] Length = 451 Score = 136 bits (343), Expect = 3e-30 Identities = 62/65 (95%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCD+KGSYV+QFEHTILLRP+CKEVIS Sbjct: 387 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDVKGSYVSQFEHTILLRPSCKEVIS 446 Query: 238 RGDDY 224 RGDDY Sbjct: 447 RGDDY 451 >ref|XP_004228613.1| PREDICTED: methionine aminopeptidase 2B-like isoform 1 [Solanum lycopersicum] gi|460365449|ref|XP_004228614.1| PREDICTED: methionine aminopeptidase 2B-like isoform 2 [Solanum lycopersicum] Length = 433 Score = 136 bits (343), Expect = 3e-30 Identities = 63/65 (96%), Positives = 64/65 (98%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCD KGSYV+QFEHTILLRPTCKEVIS Sbjct: 369 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDNKGSYVSQFEHTILLRPTCKEVIS 428 Query: 238 RGDDY 224 RGDDY Sbjct: 429 RGDDY 433 >ref|XP_002529218.1| methionine aminopeptidase, putative [Ricinus communis] gi|223531336|gb|EEF33174.1| methionine aminopeptidase, putative [Ricinus communis] Length = 432 Score = 136 bits (343), Expect = 3e-30 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCD GI+QPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 368 AFCRRYLDRLGETKYLMALKNLCDTGIIQPYPPLCDIKGSYVSQFEHTILLRPTCKEVIS 427 Query: 238 RGDDY 224 RGDDY Sbjct: 428 RGDDY 432 >ref|XP_002305888.1| METHIONINE AMINOPEPTIDASE 2A family protein [Populus trichocarpa] gi|222848852|gb|EEE86399.1| METHIONINE AMINOPEPTIDASE 2A family protein [Populus trichocarpa] Length = 394 Score = 136 bits (343), Expect = 3e-30 Identities = 61/65 (93%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCD+GI+QPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 330 AFCRRYLDRLGETKYLMALKNLCDSGIIQPYPPLCDVKGSYVSQFEHTILLRPTCKEVIS 389 Query: 238 RGDDY 224 RGDDY Sbjct: 390 RGDDY 394 >ref|XP_007142586.1| hypothetical protein PHAVU_007G000100g [Phaseolus vulgaris] gi|561015776|gb|ESW14580.1| hypothetical protein PHAVU_007G000100g [Phaseolus vulgaris] Length = 424 Score = 135 bits (341), Expect = 4e-30 Identities = 61/65 (93%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCD+GIVQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 360 AFCRRYLDRLGETKYLMALKNLCDSGIVQPYPPLCDVKGSYVSQFEHTILLRPTCKEVIS 419 Query: 238 RGDDY 224 +GDDY Sbjct: 420 KGDDY 424 >ref|XP_003555103.1| PREDICTED: methionine aminopeptidase 2B-like isoform X1 [Glycine max] Length = 430 Score = 135 bits (341), Expect = 4e-30 Identities = 61/65 (93%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCD+GIVQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 366 AFCRRYLDRLGETKYLMALKNLCDSGIVQPYPPLCDVKGSYVSQFEHTILLRPTCKEVIS 425 Query: 238 RGDDY 224 +GDDY Sbjct: 426 KGDDY 430 >ref|XP_006664225.1| PREDICTED: methionine aminopeptidase 2B-like [Oryza brachyantha] Length = 454 Score = 135 bits (340), Expect = 6e-30 Identities = 61/65 (93%), Positives = 64/65 (98%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCD GIVQPYPPLCD++GSYV+QFEHTILLRPTCKEVIS Sbjct: 390 AFCRRYLDRLGETKYLMALKNLCDVGIVQPYPPLCDVRGSYVSQFEHTILLRPTCKEVIS 449 Query: 238 RGDDY 224 RGDDY Sbjct: 450 RGDDY 454 >ref|XP_006579793.1| PREDICTED: methionine aminopeptidase 2B-like isoform X3 [Glycine max] Length = 426 Score = 135 bits (340), Expect = 6e-30 Identities = 60/65 (92%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCD+G+VQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 362 AFCRRYLDRLGETKYLMALKNLCDSGVVQPYPPLCDVKGSYVSQFEHTILLRPTCKEVIS 421 Query: 238 RGDDY 224 +GDDY Sbjct: 422 KGDDY 426 >ref|XP_006579792.1| PREDICTED: methionine aminopeptidase 2B-like isoform X2 [Glycine max] Length = 427 Score = 135 bits (340), Expect = 6e-30 Identities = 60/65 (92%), Positives = 65/65 (100%) Frame = -1 Query: 418 AFCRRYLDRLGETKYLMALKNLCDAGIVQPYPPLCDLKGSYVAQFEHTILLRPTCKEVIS 239 AFCRRYLDRLGETKYLMALKNLCD+G+VQPYPPLCD+KGSYV+QFEHTILLRPTCKEVIS Sbjct: 363 AFCRRYLDRLGETKYLMALKNLCDSGVVQPYPPLCDVKGSYVSQFEHTILLRPTCKEVIS 422 Query: 238 RGDDY 224 +GDDY Sbjct: 423 KGDDY 427