BLASTX nr result
ID: Mentha24_contig00028729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00028729 (664 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22326.1| hypothetical protein MIMGU_mgv1a025822mg [Mimulus... 50 7e-10 >gb|EYU22326.1| hypothetical protein MIMGU_mgv1a025822mg [Mimulus guttatus] Length = 319 Score = 50.1 bits (118), Expect(3) = 7e-10 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 8/50 (16%) Frame = -1 Query: 508 KQKEHPQQGLCLSTSTADSGWFSSECGGSAAA--------DEETKTLVSS 383 K+K++ L LSTS+ADSGWFSSE GG+AAA +EET+TLVSS Sbjct: 133 KKKKNIPSRLRLSTSSADSGWFSSEGGGAAAAAAAGGQMDEEETETLVSS 182 Score = 36.6 bits (83), Expect(3) = 7e-10 Identities = 20/39 (51%), Positives = 24/39 (61%) Frame = -3 Query: 356 AAAKCETPCGNRCSFAQISCTVGGKVKKSFTIVKRSKDP 240 AAA+ ET I CTV GKVK+SF +VKRS +P Sbjct: 209 AAAEGETAARLSVFKKLIPCTVEGKVKESFAVVKRSDEP 247 Score = 22.7 bits (47), Expect(3) = 7e-10 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -2 Query: 225 QLLQCILPLNSKN 187 QLLQC L LNS++ Sbjct: 272 QLLQCFLSLNSRH 284