BLASTX nr result
ID: Mentha24_contig00027994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00027994 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O24160.1|TGA21_TOBAC RecName: Full=TGACG-sequence-specific DN... 70 2e-10 gb|EYU18627.1| hypothetical protein MIMGU_mgv1a006504mg [Mimulus... 60 4e-07 ref|XP_006351371.1| PREDICTED: TGACG-sequence-specific DNA-bindi... 59 5e-07 gb|ACV53508.1| leucine zipper transcription factor TGA [Capsicum... 59 5e-07 gb|EPS70828.1| hypothetical protein M569_03931 [Genlisea aurea] 58 1e-06 gb|AHN63210.1| transcription factor TGA2 [Salvia miltiorrhiza f.... 58 2e-06 >sp|O24160.1|TGA21_TOBAC RecName: Full=TGACG-sequence-specific DNA-binding protein TGA-2.1; Short=TGA2.1 gi|2281449|gb|AAB68661.1| leucine zipper transcription factor TGA2.1 [Nicotiana tabacum] Length = 456 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +2 Query: 221 NRSGNTVMPSFISQTPVSNAMGTEANATQSSQVPNFGVLEQYLGF 355 NRSG T MPSFISQ PVSN MGTEAN T +S++ +FGVLEQYLGF Sbjct: 10 NRSGTTGMPSFISQIPVSNPMGTEANNTNTSRMSDFGVLEQYLGF 54 >gb|EYU18627.1| hypothetical protein MIMGU_mgv1a006504mg [Mimulus guttatus] Length = 441 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/48 (68%), Positives = 38/48 (79%), Gaps = 3/48 (6%) Frame = +2 Query: 221 NRSGNTVMPSFISQTP---VSNAMGTEANATQSSQVPNFGVLEQYLGF 355 NRSG MPSFISQTP ++ MGTEANA QSS+V ++GVLEQYLGF Sbjct: 14 NRSG---MPSFISQTPPPATNHPMGTEANAIQSSRVADYGVLEQYLGF 58 >ref|XP_006351371.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like [Solanum tuberosum] Length = 446 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +2 Query: 242 MPSFISQTPVSNAMGTEANATQSSQVPNFGVLEQYLGF 355 MPSFISQ PVSN MGTE N T +S++ FGVLEQYLGF Sbjct: 1 MPSFISQIPVSNHMGTEGNNTNTSRMSEFGVLEQYLGF 38 >gb|ACV53508.1| leucine zipper transcription factor TGA [Capsicum annuum] Length = 445 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +2 Query: 242 MPSFISQTPVSNAMGTEANATQSSQVPNFGVLEQYLGF 355 MPSFISQ PVSN MGTE N T +S++ FGVLEQYLGF Sbjct: 1 MPSFISQIPVSNHMGTEGNNTNTSRMSEFGVLEQYLGF 38 >gb|EPS70828.1| hypothetical protein M569_03931 [Genlisea aurea] Length = 474 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +2 Query: 242 MPSFISQTPVSNAMGTEANATQSSQVPNFGVLEQYLGF 355 MPSFISQ PVSN MG+E+ A Q+S + +FGVLEQYLGF Sbjct: 21 MPSFISQPPVSNPMGSESTAGQASTISDFGVLEQYLGF 58 >gb|AHN63210.1| transcription factor TGA2 [Salvia miltiorrhiza f. alba] Length = 460 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +2 Query: 221 NRSGNTVMPSFISQTPVSNAMGTEANATQSSQVPNFGVLEQYLGF 355 NR ++ MPSFISQ P+SN +G EANA Q+S P+ G LEQY+GF Sbjct: 13 NRRASSGMPSFISQAPLSNTIGKEANAAQTSVRPDLGGLEQYIGF 57