BLASTX nr result
ID: Mentha24_contig00027895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00027895 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31008.1| hypothetical protein MIMGU_mgv1a020790mg, partial... 58 1e-06 >gb|EYU31008.1| hypothetical protein MIMGU_mgv1a020790mg, partial [Mimulus guttatus] Length = 448 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/60 (48%), Positives = 43/60 (71%), Gaps = 3/60 (5%) Frame = +3 Query: 6 IVKENERVKYDEP---LLPRLKELVLRHLPHLVALGRGLFPSEKIIKLHFCPKLVLSPDP 176 IVKE ++ + LLPRL++LVLR LP+LV+ G GL PS++I+K+ CPKL+ + +P Sbjct: 385 IVKEEKKSRVTTSNAILLPRLRKLVLRFLPNLVSFGNGLCPSKEIVKIQECPKLIHNSEP 444