BLASTX nr result
ID: Mentha24_contig00027845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00027845 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34720.1| hypothetical protein MIMGU_mgv1a002857mg [Mimulus... 75 7e-12 gb|EPS68138.1| hypothetical protein M569_06638 [Genlisea aurea] 60 4e-07 >gb|EYU34720.1| hypothetical protein MIMGU_mgv1a002857mg [Mimulus guttatus] Length = 630 Score = 75.5 bits (184), Expect = 7e-12 Identities = 49/110 (44%), Positives = 62/110 (56%), Gaps = 4/110 (3%) Frame = +3 Query: 3 KKSKYLSFPYTNPAWRVGNSSFKFESQFQNDEATKKPHVEEHTEEQDIAVSQPSIKSVDS 182 KKSKYLS PYTNP WRVGNSSFK T +P E + + I S ++ V+ Sbjct: 378 KKSKYLSPPYTNPTWRVGNSSFK----------TTEPAAESNDKITKIPPSVENVAIVEK 427 Query: 183 ESQEKLPNG--ESVGTYAETGTQTI--KDDKNLSFPMSDVDVPVNELLSE 320 S++ L NG E ET +TI D+K L+F +SDV V+ELLSE Sbjct: 428 ASEKNLTNGKLEEPEISVETTPKTIIKNDEKKLTFNVSDVGASVSELLSE 477 >gb|EPS68138.1| hypothetical protein M569_06638 [Genlisea aurea] Length = 759 Score = 59.7 bits (143), Expect = 4e-07 Identities = 36/107 (33%), Positives = 62/107 (57%), Gaps = 3/107 (2%) Frame = +3 Query: 3 KKSKYLSFPYTNPAWRVGNSSFKFESQFQNDEATKKPHVEEHTE-EQDIAVSQPSIKSVD 179 K SKYLS+PY P W++G ++FK S + + KK H+ E E + + SQ + V+ Sbjct: 432 KVSKYLSYPYIIPEWKIGYTNFKLGS--EASKTPKKDHLPIQEEPELEASSSQQKLVVVN 489 Query: 180 SESQEKLPNGESV--GTYAETGTQTIKDDKNLSFPMSDVDVPVNELL 314 + S ++ P +++ A +G++ +D +SFP+SDV + +ELL Sbjct: 490 TSSDKEHPFDDTIEQSKSASSGSRLDHNDVKMSFPVSDVTLSPDELL 536