BLASTX nr result
ID: Mentha24_contig00027485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00027485 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28928.1| hypothetical protein MIMGU_mgv1a010894mg [Mimulus... 88 1e-15 >gb|EYU28928.1| hypothetical protein MIMGU_mgv1a010894mg [Mimulus guttatus] Length = 298 Score = 87.8 bits (216), Expect = 1e-15 Identities = 54/104 (51%), Positives = 63/104 (60%), Gaps = 9/104 (8%) Frame = +2 Query: 2 VLKFNLH---------HRYRHRPSIRPPEPHFLSLTFREQTVKVSPPVVGALCFSTKHAR 154 +LK N H HR+RHR P + T Q+ K+SP + L TK A+ Sbjct: 3 LLKLNFHPYHHHRRHRHRHRHRQIKLPAQSLSSFPTSDGQSFKLSPSIATPLYSLTKCAK 62 Query: 155 NSKINAATSFSIGKNKDEEEIGDFEEYLAEDGAVYQKTLRLVEC 286 NSKINAA SI KN+DEE I +FEEYLAEDG VYQKTLRLVEC Sbjct: 63 NSKINAAIPISIEKNEDEE-IEEFEEYLAEDGEVYQKTLRLVEC 105