BLASTX nr result
ID: Mentha24_contig00027175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00027175 (579 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45593.1| hypothetical protein MIMGU_mgv1a012297mg [Mimulus... 64 4e-08 >gb|EYU45593.1| hypothetical protein MIMGU_mgv1a012297mg [Mimulus guttatus] Length = 254 Score = 63.5 bits (153), Expect = 4e-08 Identities = 43/100 (43%), Positives = 53/100 (53%), Gaps = 3/100 (3%) Frame = -2 Query: 578 HDSRDRGYGASDGRYSGHRSRSMSRSASPKVE---XXXXXXXXXXXXXXXXXSPQDEEMH 408 H+SR +GYGA D +S RSRS+SRS SP+ E SP DE+ H Sbjct: 158 HESRGKGYGARDDYHSPRRSRSISRSVSPRNERNHRSREKPTRRSRSFSRSVSPLDEKNH 217 Query: 407 RPSVRSPSPRENGRGGYGSRSQSPRRNSMSPVGRR*RSTS 288 R RS +P+EN RS+SP+RNS SP R RS S Sbjct: 218 RQIRRSTNPKEN-----APRSRSPKRNSRSPSRSRSRSYS 252