BLASTX nr result
ID: Mentha24_contig00026817
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00026817 (457 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39758.1| hypothetical protein MIMGU_mgv1a000633mg [Mimulus... 64 3e-08 >gb|EYU39758.1| hypothetical protein MIMGU_mgv1a000633mg [Mimulus guttatus] Length = 1038 Score = 63.5 bits (153), Expect = 3e-08 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 3/60 (5%) Frame = -3 Query: 455 EAKFHRIRVRYSITGKRMPMNRKANN-PLPSQTNLL-RSDF-QINSACDVVDQLRHLHSP 285 + KFHRIRVRYSITGK PM RK ++ P P Q+N+L RSDF Q++ +CD VD L +L SP Sbjct: 979 DPKFHRIRVRYSITGKLTPMIRKDDSTPTPVQSNMLHRSDFHQLSGSCDFVDHLINLDSP 1038