BLASTX nr result
ID: Mentha24_contig00026781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00026781 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544155.1| PREDICTED: phosphatidylinositol 4-phosphate ... 93 4e-17 ref|XP_003543784.1| PREDICTED: phosphatidylinositol 4-phosphate ... 93 4e-17 ref|XP_004167695.1| PREDICTED: phosphatidylinositol 4-phosphate ... 92 6e-17 ref|XP_004140328.1| PREDICTED: phosphatidylinositol 4-phosphate ... 92 6e-17 ref|XP_004290830.1| PREDICTED: phosphatidylinositol 4-phosphate ... 92 8e-17 ref|XP_004513834.1| PREDICTED: phosphatidylinositol 4-phosphate ... 91 1e-16 gb|EYU23920.1| hypothetical protein MIMGU_mgv1a001547mg [Mimulus... 91 2e-16 ref|XP_007137365.1| hypothetical protein PHAVU_009G121200g [Phas... 91 2e-16 ref|XP_006472714.1| PREDICTED: phosphatidylinositol 4-phosphate ... 91 2e-16 ref|XP_006434121.1| hypothetical protein CICLE_v10000334mg [Citr... 91 2e-16 ref|XP_002301013.2| putative phosphatidylinositol-4-phosphate 5-... 91 2e-16 ref|XP_004150913.1| PREDICTED: phosphatidylinositol 4-phosphate ... 91 2e-16 ref|XP_002307416.1| putative phosphatidylinositol-4-phosphate 5-... 91 2e-16 gb|EYU22913.1| hypothetical protein MIMGU_mgv1a001594mg [Mimulus... 90 3e-16 gb|EXB44331.1| Phosphatidylinositol-4-phosphate 5-kinase 1 [Moru... 89 5e-16 ref|XP_007141094.1| hypothetical protein PHAVU_008G166900g [Phas... 89 5e-16 ref|XP_007226998.1| hypothetical protein PRUPE_ppa001669mg [Prun... 89 6e-16 ref|XP_003526609.1| PREDICTED: phosphatidylinositol 4-phosphate ... 89 6e-16 ref|XP_003522588.1| PREDICTED: phosphatidylinositol 4-phosphate ... 89 6e-16 ref|XP_006584672.1| PREDICTED: phosphatidylinositol 4-phosphate ... 89 8e-16 >ref|XP_003544155.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Glycine max] Length = 705 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIE+R Sbjct: 660 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEER 705 >ref|XP_003543784.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Glycine max] Length = 708 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIE+R Sbjct: 663 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEER 708 >ref|XP_004167695.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Cucumis sativus] Length = 786 Score = 92.4 bits (228), Expect = 6e-17 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQVD TSISAVDPKLYSKRFRDFVGRIFIEDR Sbjct: 741 DYDISKKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVGRIFIEDR 786 >ref|XP_004140328.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Cucumis sativus] Length = 786 Score = 92.4 bits (228), Expect = 6e-17 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQVD TSISAVDPKLYSKRFRDFVGRIFIEDR Sbjct: 741 DYDISKKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVGRIFIEDR 786 >ref|XP_004290830.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Fragaria vesca subsp. vesca] Length = 768 Score = 92.0 bits (227), Expect = 8e-17 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQVD TSISAVDPKLYSKRFRDF+GRIFIEDR Sbjct: 723 DYDISKKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFIGRIFIEDR 768 >ref|XP_004513834.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Cicer arietinum] Length = 739 Score = 91.3 bits (225), Expect = 1e-16 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIED 135 DYDISKKLEHAYKSLQVD+TSISAVDPKLYSKRFRDFVGRIFIED Sbjct: 694 DYDISKKLEHAYKSLQVDATSISAVDPKLYSKRFRDFVGRIFIED 738 >gb|EYU23920.1| hypothetical protein MIMGU_mgv1a001547mg [Mimulus guttatus] Length = 798 Score = 90.9 bits (224), Expect = 2e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQVD TSISAVDPKLYS+RFRDF+GRIFIEDR Sbjct: 753 DYDISKKLEHAYKSLQVDPTSISAVDPKLYSRRFRDFIGRIFIEDR 798 >ref|XP_007137365.1| hypothetical protein PHAVU_009G121200g [Phaseolus vulgaris] gi|561010452|gb|ESW09359.1| hypothetical protein PHAVU_009G121200g [Phaseolus vulgaris] Length = 722 Score = 90.9 bits (224), Expect = 2e-16 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQVD +SISAVDPKLYSKRFRDFVGRIFIEDR Sbjct: 677 DYDISKKLEHAYKSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 722 >ref|XP_006472714.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Citrus sinensis] Length = 791 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQ D TSISAVDPKLYSKRFRDF+GRIFIEDR Sbjct: 746 DYDISKKLEHAYKSLQADPTSISAVDPKLYSKRFRDFIGRIFIEDR 791 >ref|XP_006434121.1| hypothetical protein CICLE_v10000334mg [Citrus clementina] gi|557536243|gb|ESR47361.1| hypothetical protein CICLE_v10000334mg [Citrus clementina] Length = 791 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQ D TSISAVDPKLYSKRFRDF+GRIFIEDR Sbjct: 746 DYDISKKLEHAYKSLQADPTSISAVDPKLYSKRFRDFIGRIFIEDR 791 >ref|XP_002301013.2| putative phosphatidylinositol-4-phosphate 5-kinase mRNA family protein [Populus trichocarpa] gi|550344590|gb|EEE80286.2| putative phosphatidylinositol-4-phosphate 5-kinase mRNA family protein [Populus trichocarpa] Length = 801 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQ D TSISAVDPKLYSKRFRDF+GRIFIEDR Sbjct: 756 DYDISKKLEHAYKSLQADPTSISAVDPKLYSKRFRDFIGRIFIEDR 801 >ref|XP_004150913.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Cucumis sativus] gi|449522139|ref|XP_004168085.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Cucumis sativus] Length = 791 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQVD +SISAVDPKLYSKRFRDF+GRIFIEDR Sbjct: 746 DYDISKKLEHAYKSLQVDPSSISAVDPKLYSKRFRDFIGRIFIEDR 791 >ref|XP_002307416.1| putative phosphatidylinositol-4-phosphate 5-kinase mRNA family protein [Populus trichocarpa] gi|222856865|gb|EEE94412.1| putative phosphatidylinositol-4-phosphate 5-kinase mRNA family protein [Populus trichocarpa] Length = 789 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQ D TSISAVDPKLYSKRFRDF+GRIFIEDR Sbjct: 744 DYDISKKLEHAYKSLQADPTSISAVDPKLYSKRFRDFIGRIFIEDR 789 >gb|EYU22913.1| hypothetical protein MIMGU_mgv1a001594mg [Mimulus guttatus] Length = 789 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQVD TSISAVDPKLYSKRFRDFVGR+F EDR Sbjct: 744 DYDISKKLEHAYKSLQVDPTSISAVDPKLYSKRFRDFVGRVFTEDR 789 >gb|EXB44331.1| Phosphatidylinositol-4-phosphate 5-kinase 1 [Morus notabilis] Length = 738 Score = 89.4 bits (220), Expect = 5e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQ D TSISAVDPKLYS+RFRDF+GRIFIEDR Sbjct: 693 DYDISKKLEHAYKSLQADPTSISAVDPKLYSRRFRDFIGRIFIEDR 738 >ref|XP_007141094.1| hypothetical protein PHAVU_008G166900g [Phaseolus vulgaris] gi|561014227|gb|ESW13088.1| hypothetical protein PHAVU_008G166900g [Phaseolus vulgaris] Length = 709 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQVD +SISAVDPKLYSKRFRDFVGRIFIE+R Sbjct: 664 DYDISKKLEHAYKSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEER 709 >ref|XP_007226998.1| hypothetical protein PRUPE_ppa001669mg [Prunus persica] gi|462423934|gb|EMJ28197.1| hypothetical protein PRUPE_ppa001669mg [Prunus persica] Length = 783 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKKLEHAYKSLQ D +SISAVDPKLYSKRFRDF+GRIFIEDR Sbjct: 738 DYDISKKLEHAYKSLQADPSSISAVDPKLYSKRFRDFIGRIFIEDR 783 >ref|XP_003526609.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Glycine max] Length = 717 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIED 135 DYDISKKLEHAYKSLQVD +SISAVDPKLYSKRFRDFVGRIFIED Sbjct: 672 DYDISKKLEHAYKSLQVDPSSISAVDPKLYSKRFRDFVGRIFIED 716 >ref|XP_003522588.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Glycine max] Length = 702 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIED 135 DYDISKKLEHAYKSLQVD +SISAVDPKLYSKRFRDFVGRIFIED Sbjct: 657 DYDISKKLEHAYKSLQVDPSSISAVDPKLYSKRFRDFVGRIFIED 701 >ref|XP_006584672.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Glycine max] Length = 719 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +1 Query: 1 DYDISKKLEHAYKSLQVDSTSISAVDPKLYSKRFRDFVGRIFIEDR 138 DYDISKK+EHAYKSLQVDSTSISAVDPKLYSKRFRDF+ RIF+ED+ Sbjct: 674 DYDISKKIEHAYKSLQVDSTSISAVDPKLYSKRFRDFIHRIFVEDK 719