BLASTX nr result
ID: Mentha24_contig00026675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00026675 (438 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41923.1| hypothetical protein MIMGU_mgv1a007461mg [Mimulus... 66 6e-09 gb|EYU41922.1| hypothetical protein MIMGU_mgv1a007461mg [Mimulus... 66 6e-09 ref|XP_006366338.1| PREDICTED: chlorophyll synthase, chloroplast... 66 6e-09 ref|XP_004246318.1| PREDICTED: chlorophyll synthase, chloroplast... 66 6e-09 gb|AEI83422.1| chlorophyll synthase [Camellia sinensis] 66 6e-09 gb|ACQ44245.1| chlorophyll synthase [Nicotiana tabacum] 66 6e-09 gb|ACQ44244.1| chlorophyll synthase [Nicotiana tabacum] 66 6e-09 gb|ADK95060.1| chloroplast chlorophyll synthase [Gossypium hirsu... 65 8e-09 ref|XP_007140250.1| hypothetical protein PHAVU_008G096500g [Phas... 65 8e-09 ref|XP_006429429.1| hypothetical protein CICLE_v10011985mg [Citr... 65 8e-09 ref|XP_004492466.1| PREDICTED: chlorophyll synthase, chloroplast... 65 8e-09 ref|XP_004492465.1| PREDICTED: chlorophyll synthase, chloroplast... 65 8e-09 ref|XP_004148612.1| PREDICTED: chlorophyll synthase, chloroplast... 65 8e-09 ref|NP_001239633.1| uncharacterized protein LOC100787459 [Glycin... 65 8e-09 ref|XP_002530507.1| bacteriochlorophyll synthase, putative [Rici... 65 8e-09 ref|XP_002308227.1| chlorophyll synthetase family protein [Popul... 65 8e-09 ref|XP_002263271.1| PREDICTED: chlorophyll synthase, chloroplast... 65 8e-09 ref|XP_004302558.1| PREDICTED: chlorophyll synthase, chloroplast... 65 1e-08 ref|XP_006655220.1| PREDICTED: chlorophyll synthase, chloroplast... 64 2e-08 gb|EPS69266.1| hypothetical protein M569_05500, partial [Genlise... 64 2e-08 >gb|EYU41923.1| hypothetical protein MIMGU_mgv1a007461mg [Mimulus guttatus] Length = 404 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 373 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 404 >gb|EYU41922.1| hypothetical protein MIMGU_mgv1a007461mg [Mimulus guttatus] Length = 406 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 375 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 406 >ref|XP_006366338.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Solanum tuberosum] Length = 369 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 338 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 369 >ref|XP_004246318.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Solanum lycopersicum] Length = 369 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 338 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 369 >gb|AEI83422.1| chlorophyll synthase [Camellia sinensis] Length = 374 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 343 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 374 >gb|ACQ44245.1| chlorophyll synthase [Nicotiana tabacum] Length = 373 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 342 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >gb|ACQ44244.1| chlorophyll synthase [Nicotiana tabacum] Length = 373 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 342 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >gb|ADK95060.1| chloroplast chlorophyll synthase [Gossypium hirsutum] Length = 379 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 348 LKDPVKYDVKYQASAQPFLVLGLLVTALATSH 379 >ref|XP_007140250.1| hypothetical protein PHAVU_008G096500g [Phaseolus vulgaris] gi|561013383|gb|ESW12244.1| hypothetical protein PHAVU_008G096500g [Phaseolus vulgaris] Length = 377 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 346 LKDPVKYDVKYQASAQPFLVLGLLVTALATSH 377 >ref|XP_006429429.1| hypothetical protein CICLE_v10011985mg [Citrus clementina] gi|568854920|ref|XP_006481064.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Citrus sinensis] gi|557531486|gb|ESR42669.1| hypothetical protein CICLE_v10011985mg [Citrus clementina] Length = 374 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDP+KYDVKYQASAQPFLILGLLVTALATSH Sbjct: 343 LKDPIKYDVKYQASAQPFLILGLLVTALATSH 374 >ref|XP_004492466.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X2 [Cicer arietinum] Length = 378 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 347 LKDPVKYDVKYQASAQPFLVLGLLVTALATSH 378 >ref|XP_004492465.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X1 [Cicer arietinum] Length = 379 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 348 LKDPVKYDVKYQASAQPFLVLGLLVTALATSH 379 >ref|XP_004148612.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Cucumis sativus] gi|449517004|ref|XP_004165536.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Cucumis sativus] Length = 373 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 342 LKDPVKYDVKYQASAQPFLVLGLLVTALATSH 373 >ref|NP_001239633.1| uncharacterized protein LOC100787459 [Glycine max] gi|255647387|gb|ACU24159.1| unknown [Glycine max] Length = 377 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 346 LKDPVKYDVKYQASAQPFLVLGLLVTALATSH 377 >ref|XP_002530507.1| bacteriochlorophyll synthase, putative [Ricinus communis] gi|223529964|gb|EEF31891.1| bacteriochlorophyll synthase, putative [Ricinus communis] Length = 344 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 313 LKDPVKYDVKYQASAQPFLVLGLLVTALATSH 344 >ref|XP_002308227.1| chlorophyll synthetase family protein [Populus trichocarpa] gi|118486377|gb|ABK95029.1| unknown [Populus trichocarpa] gi|222854203|gb|EEE91750.1| chlorophyll synthetase family protein [Populus trichocarpa] Length = 372 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 341 LKDPVKYDVKYQASAQPFLVLGLLVTALATSH 372 >ref|XP_002263271.1| PREDICTED: chlorophyll synthase, chloroplastic [Vitis vinifera] gi|296083177|emb|CBI22813.3| unnamed protein product [Vitis vinifera] Length = 370 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 339 LKDPVKYDVKYQASAQPFLVLGLLVTALATSH 370 >ref|XP_004302558.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 374 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPFL+LG+LVTALATSH Sbjct: 343 LKDPVKYDVKYQASAQPFLVLGILVTALATSH 374 >ref|XP_006655220.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Oryza brachyantha] Length = 337 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 LKDPVKYDVKYQASAQPF +LGLLVTALATSH Sbjct: 306 LKDPVKYDVKYQASAQPFFVLGLLVTALATSH 337 >gb|EPS69266.1| hypothetical protein M569_05500, partial [Genlisea aurea] Length = 383 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 LKDPVKYDVKYQASAQPFLILGLLVTALATSH 98 L+DPVKYDVKYQASAQPFLI+GLLVTALATSH Sbjct: 352 LRDPVKYDVKYQASAQPFLIMGLLVTALATSH 383