BLASTX nr result
ID: Mentha24_contig00026672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00026672 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42724.1| hypothetical protein MIMGU_mgv1a009970mg [Mimulus... 69 7e-10 ref|XP_007218338.1| hypothetical protein PRUPE_ppa008591mg [Prun... 67 2e-09 ref|XP_004307417.1| PREDICTED: Golgi to ER traffic protein 4 hom... 66 6e-09 emb|CBI31514.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002278274.1| PREDICTED: Golgi to ER traffic protein 4 hom... 62 6e-08 ref|XP_006364258.1| PREDICTED: Golgi to ER traffic protein 4 hom... 62 1e-07 ref|XP_004244790.1| PREDICTED: Golgi to ER traffic protein 4 hom... 61 1e-07 gb|ACJ85255.1| unknown [Medicago truncatula] 61 1e-07 ref|XP_003591984.1| hypothetical protein MTR_1g095910 [Medicago ... 61 1e-07 ref|XP_003556214.1| PREDICTED: Golgi to ER traffic protein 4 hom... 58 1e-06 ref|NP_001239772.1| uncharacterized protein LOC100780059 [Glycin... 58 1e-06 ref|XP_004496342.1| PREDICTED: Golgi to ER traffic protein 4 hom... 58 2e-06 ref|XP_006281506.1| hypothetical protein CARUB_v10027604mg [Caps... 58 2e-06 ref|NP_201127.2| uncharacterized protein [Arabidopsis thaliana] ... 58 2e-06 ref|XP_002866541.1| hypothetical protein ARALYDRAFT_496506 [Arab... 58 2e-06 ref|XP_006436210.1| hypothetical protein CICLE_v10032131mg [Citr... 57 2e-06 ref|XP_002523898.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 gb|EXC19492.1| hypothetical protein L484_014122 [Morus notabilis] 57 3e-06 ref|XP_007143670.1| hypothetical protein PHAVU_007G091600g [Phas... 57 3e-06 ref|XP_002312037.2| hypothetical protein POPTR_0008s04370g [Popu... 57 3e-06 >gb|EYU42724.1| hypothetical protein MIMGU_mgv1a009970mg [Mimulus guttatus] Length = 326 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMMAGE 133 SI RE +F+ELLDEVAEKFYGV+RRN MP GMFGE+FKMM+G+ Sbjct: 285 SIDREPIFSELLDEVAEKFYGVQRRNQMP-GMFGELFKMMSGD 326 >ref|XP_007218338.1| hypothetical protein PRUPE_ppa008591mg [Prunus persica] gi|462414800|gb|EMJ19537.1| hypothetical protein PRUPE_ppa008591mg [Prunus persica] Length = 326 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPG-GMFGEIFKMMAGE 133 S+ RE F+ELLDE+AEKFYGVRRRN + G GMFGEIFKMM GE Sbjct: 283 SLDREPTFHELLDEIAEKFYGVRRRNPLQGMGMFGEIFKMMGGE 326 >ref|XP_004307417.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Fragaria vesca subsp. vesca] Length = 327 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/44 (72%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPG-GMFGEIFKMMAGE 133 S+ RE F+ELLDE+AEKFYGVRRRN + G GMFGEIFKMM G+ Sbjct: 284 SLDREPSFHELLDEIAEKFYGVRRRNPLQGMGMFGEIFKMMGGD 327 >emb|CBI31514.3| unnamed protein product [Vitis vinifera] Length = 684 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMMA 127 SI RE FNELLDE+AEKFYGVRRRN M GMFG+ FK+MA Sbjct: 645 SIDREPAFNELLDEIAEKFYGVRRRNPMQ-GMFGDFFKLMA 684 >ref|XP_002278274.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Vitis vinifera] Length = 322 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMMA 127 SI RE FNELLDE+AEKFYGVRRRN M GMFG+ FK+MA Sbjct: 283 SIDREPAFNELLDEIAEKFYGVRRRNPMQ-GMFGDFFKLMA 322 >ref|XP_006364258.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Solanum tuberosum] Length = 328 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMMAGE 133 SI R+ LFNELLDEVA+KFYGV+R++ + GMFG+IFKMM GE Sbjct: 287 SIDRDPLFNELLDEVAKKFYGVQRKSPLQ-GMFGDIFKMMGGE 328 >ref|XP_004244790.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Solanum lycopersicum] Length = 328 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMMAGE 133 SI R+ LFNELLDEVA+KFYG++R++ + GMFG+IFKMM GE Sbjct: 287 SIDRDPLFNELLDEVAKKFYGIQRKSPLQ-GMFGDIFKMMGGE 328 >gb|ACJ85255.1| unknown [Medicago truncatula] Length = 221 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMMAGE 133 SI RE FNELLDE+A+KFYGV+RRN P GMFG+IFK+M E Sbjct: 181 SIEREPSFNELLDEIAQKFYGVQRRN--PMGMFGDIFKLMGAE 221 >ref|XP_003591984.1| hypothetical protein MTR_1g095910 [Medicago truncatula] gi|355481032|gb|AES62235.1| hypothetical protein MTR_1g095910 [Medicago truncatula] gi|388501440|gb|AFK38786.1| unknown [Medicago truncatula] Length = 323 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMMAGE 133 SI RE FNELLDE+A+KFYGV+RRN P GMFG+IFK+M E Sbjct: 283 SIEREPSFNELLDEIAQKFYGVQRRN--PMGMFGDIFKLMGAE 323 >ref|XP_003556214.1| PREDICTED: Golgi to ER traffic protein 4 homolog isoform X1 [Glycine max] Length = 323 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMMAGE 133 SI RE FNE+LD++AE+F+GV+RRN P GMFG+IFK+M E Sbjct: 283 SIEREPAFNEMLDDIAERFFGVQRRN--PMGMFGDIFKLMGAE 323 >ref|NP_001239772.1| uncharacterized protein LOC100780059 [Glycine max] gi|255636423|gb|ACU18550.1| unknown [Glycine max] Length = 323 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMMAGE 133 SI RE FNE+LD++AE+F+GV+RRN P GMFG+IFK+M E Sbjct: 283 SIEREPAFNEMLDDIAERFFGVQRRN--PMGMFGDIFKLMGAE 323 >ref|XP_004496342.1| PREDICTED: Golgi to ER traffic protein 4 homolog isoform X3 [Cicer arietinum] Length = 323 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMM 124 SI RE NE+LD++AEKFYGV+RRN P GMFG+IFKMM Sbjct: 283 SIEREPALNEMLDDIAEKFYGVQRRN--PMGMFGDIFKMM 320 >ref|XP_006281506.1| hypothetical protein CARUB_v10027604mg [Capsella rubella] gi|482550210|gb|EOA14404.1| hypothetical protein CARUB_v10027604mg [Capsella rubella] Length = 324 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMM 124 SI R+ L NELLDE+AE+FYGV+R+N + GMFG+IFKMM Sbjct: 285 SIDRDQLLNELLDEIAERFYGVQRKNPLQ-GMFGDIFKMM 323 >ref|NP_201127.2| uncharacterized protein [Arabidopsis thaliana] gi|48958523|gb|AAT47814.1| At5g63220 [Arabidopsis thaliana] gi|51970596|dbj|BAD43990.1| putative protein [Arabidopsis thaliana] gi|332010336|gb|AED97719.1| uncharacterized protein AT5G63220 [Arabidopsis thaliana] Length = 324 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMM 124 SI R+ L NELLDE+AE+FYGV+R+N + GMFG+IFKMM Sbjct: 285 SIDRDQLLNELLDEIAERFYGVQRKNPLQ-GMFGDIFKMM 323 >ref|XP_002866541.1| hypothetical protein ARALYDRAFT_496506 [Arabidopsis lyrata subsp. lyrata] gi|297312376|gb|EFH42800.1| hypothetical protein ARALYDRAFT_496506 [Arabidopsis lyrata subsp. lyrata] Length = 324 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMM 124 SI R+ L NELLDE+AE+FYGV+R+N + GMFG+IFKMM Sbjct: 285 SIDRDQLLNELLDEIAERFYGVQRKNPLQ-GMFGDIFKMM 323 >ref|XP_006436210.1| hypothetical protein CICLE_v10032131mg [Citrus clementina] gi|568865133|ref|XP_006485932.1| PREDICTED: Golgi to ER traffic protein 4 homolog [Citrus sinensis] gi|557538406|gb|ESR49450.1| hypothetical protein CICLE_v10032131mg [Citrus clementina] Length = 321 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMM 124 SI RE FNE+LD++AEKF+GV+RRN M G+FG+IFKMM Sbjct: 283 SIEREPAFNEMLDDIAEKFFGVKRRNPMQ-GIFGDIFKMM 321 >ref|XP_002523898.1| conserved hypothetical protein [Ricinus communis] gi|223536828|gb|EEF38467.1| conserved hypothetical protein [Ricinus communis] Length = 324 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMM 124 SI RE +FNELLDE+AEK YG++RRN + GMFG+IFKM+ Sbjct: 286 SIDREPVFNELLDEIAEKLYGIQRRNPLQ-GMFGDIFKMI 324 >gb|EXC19492.1| hypothetical protein L484_014122 [Morus notabilis] Length = 339 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKM 121 S+ RE F ELLDE+AEKFYGVRRRN + GMFGEIFK+ Sbjct: 283 SLDREPSFKELLDEIAEKFYGVRRRNPLQ-GMFGEIFKL 320 >ref|XP_007143670.1| hypothetical protein PHAVU_007G091600g [Phaseolus vulgaris] gi|543177247|gb|AGV54645.1| golgi to ER traffic protein 4 [Phaseolus vulgaris] gi|561016860|gb|ESW15664.1| hypothetical protein PHAVU_007G091600g [Phaseolus vulgaris] Length = 323 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMMAGE 133 SI RE FNE+LD+ AE+F+GV+RRN P GMFG+IFK+M E Sbjct: 283 SIEREPAFNEMLDDTAERFFGVQRRN--PMGMFGDIFKLMGAE 323 >ref|XP_002312037.2| hypothetical protein POPTR_0008s04370g [Populus trichocarpa] gi|550332409|gb|EEE89404.2| hypothetical protein POPTR_0008s04370g [Populus trichocarpa] Length = 322 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +2 Query: 5 SISREHLFNELLDEVAEKFYGVRRRNSMPGGMFGEIFKMM 124 SI RE FNELLDE+AE FYGV+RRN + GMFG+IF+MM Sbjct: 283 SIDREPAFNELLDEIAELFYGVQRRNPLQ-GMFGDIFQMM 321