BLASTX nr result
ID: Mentha24_contig00026504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00026504 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EWZ99908.1| hypothetical protein FOWG_00287 [Fusarium oxyspor... 55 8e-06 >gb|EWZ99908.1| hypothetical protein FOWG_00287 [Fusarium oxysporum f. sp. lycopersici MN25] Length = 393 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 1/103 (0%) Frame = +3 Query: 6 TNTPPTFPNQGRFGNTSPQASPGAPARAIPKQDSQPPTPSKTFGIFSALKAGATNA-SPI 182 T+ PP P+ + P+ P AP +P SQ PTP + G G A SP+ Sbjct: 211 TDAPPRIPDDPGYFPPQPEHQPQAPEPFVPSPLSQSPTPGLSGGPPPPPPVGLPPAVSPV 270 Query: 183 SPNQGRPGNNVSPETRPEAPARGGIPKQDGATPPKPFSISGTP 311 + +P + P+ P+ P + +P Q PP+PF+ S P Sbjct: 271 PESSAQPATQIPPQPSPQIPTK--LPSQFAPPPPEPFTPSAPP 311