BLASTX nr result
ID: Mentha24_contig00026259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00026259 (586 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35835.1| hypothetical protein MIMGU_mgv1a012184mg [Mimulus... 68 2e-09 >gb|EYU35835.1| hypothetical protein MIMGU_mgv1a012184mg [Mimulus guttatus] Length = 259 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = -1 Query: 241 EGRRPAATETQMPLSLLEKWLLDDAAAQGHDGDFMEMALGETADLF 104 +G + ETQMP SLLEKWLLDDAAAQG DGDFM+M L TADLF Sbjct: 214 DGSKDNILETQMPFSLLEKWLLDDAAAQGQDGDFMDMDLVGTADLF 259