BLASTX nr result
ID: Mentha24_contig00026246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00026246 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36544.1| hypothetical protein MIMGU_mgv1a014415mg [Mimulus... 72 6e-11 gb|EPS62899.1| hypothetical protein M569_11895, partial [Genlise... 60 2e-07 ref|XP_004252560.1| PREDICTED: uncharacterized protein LOC101256... 60 3e-07 ref|XP_007019684.1| Uncharacterized protein TCM_035898 [Theobrom... 59 5e-07 ref|XP_006359016.1| PREDICTED: uncharacterized protein LOC102603... 59 7e-07 ref|XP_004237842.1| PREDICTED: uncharacterized protein LOC101258... 59 7e-07 ref|XP_002527107.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 gb|EXB37796.1| hypothetical protein L484_002731 [Morus notabilis] 59 9e-07 gb|AFK47733.1| unknown [Lotus japonicus] 58 1e-06 ref|XP_003548084.1| PREDICTED: uncharacterized protein LOC100789... 57 3e-06 ref|XP_002300894.1| hypothetical protein POPTR_0002s06300g [Popu... 57 3e-06 ref|XP_007151934.1| hypothetical protein PHAVU_004G088200g [Phas... 56 6e-06 ref|XP_004489905.1| PREDICTED: uncharacterized protein LOC101498... 55 8e-06 ref|XP_002264853.1| PREDICTED: uncharacterized protein LOC100254... 55 8e-06 ref|NP_565024.1| uncharacterized protein [Arabidopsis thaliana] ... 55 1e-05 gb|AAF43231.1|AC012654_15 EST gb|Z37689 comes from this gene [Ar... 55 1e-05 ref|XP_002888847.1| hypothetical protein ARALYDRAFT_476299 [Arab... 55 1e-05 >gb|EYU36544.1| hypothetical protein MIMGU_mgv1a014415mg [Mimulus guttatus] Length = 190 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEKFF 130 ETP WA L + GP+PPW+LAC V+VFTRMRKRTKSFL+++F Sbjct: 147 ETPQWANKLNFSSGPIPPWVLACGVVVFTRMRKRTKSFLQRYF 189 >gb|EPS62899.1| hypothetical protein M569_11895, partial [Genlisea aurea] Length = 156 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLE 121 ETP WAK L + PPWILACAVIVFTRMRKRT+ FLE Sbjct: 119 ETPEWAKKLN--LSSSPPWILACAVIVFTRMRKRTRKFLE 156 >ref|XP_004252560.1| PREDICTED: uncharacterized protein LOC101256569 [Solanum lycopersicum] Length = 196 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLE 121 E PAWAK + G VPPW+LACA + FTRMRKRT+ F+E Sbjct: 153 EPPAWAKKFNLSDGRVPPWLLACAFVAFTRMRKRTRDFME 192 >ref|XP_007019684.1| Uncharacterized protein TCM_035898 [Theobroma cacao] gi|508725012|gb|EOY16909.1| Uncharacterized protein TCM_035898 [Theobroma cacao] Length = 203 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEK 124 +TP W K L G PPW+LAC VIVFTRMRKRT+ FL+K Sbjct: 160 DTPEWIKKLNIFGGDFPPWVLACIVIVFTRMRKRTRDFLKK 200 >ref|XP_006359016.1| PREDICTED: uncharacterized protein LOC102603897 [Solanum tuberosum] Length = 190 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEK 124 E+P WAK L T G +PPW+LA AVI+FTR+RKRTK F K Sbjct: 148 ESPEWAKKLNITGGNIPPWVLAAAVILFTRIRKRTKDFFGK 188 >ref|XP_004237842.1| PREDICTED: uncharacterized protein LOC101258553 [Solanum lycopersicum] Length = 190 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEK 124 E+P WAK L T G +PPW+LA AVI+FTR+RKRTK F K Sbjct: 148 ESPEWAKKLNITGGNIPPWVLAAAVILFTRIRKRTKDFFGK 188 >ref|XP_002527107.1| conserved hypothetical protein [Ricinus communis] gi|223533530|gb|EEF35270.1| conserved hypothetical protein [Ricinus communis] Length = 193 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEK 124 E P W K+ G PPWILACAVIVFTRMRKRT+ FL+K Sbjct: 150 EPPQWIKNSNLFGGSFPPWILACAVIVFTRMRKRTRDFLKK 190 >gb|EXB37796.1| hypothetical protein L484_002731 [Morus notabilis] Length = 211 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEK 124 ETP W + L G PPWILAC VIVFTRMRKRTK L+K Sbjct: 168 ETPQWMQKLNVFGGNFPPWILACVVIVFTRMRKRTKDLLQK 208 >gb|AFK47733.1| unknown [Lotus japonicus] Length = 186 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEK 124 +TP W K L + PPWILAC VIVFTRMRKRTK FL++ Sbjct: 143 DTPEWMKKLNVSSVNFPPWILACVVIVFTRMRKRTKDFLKR 183 >ref|XP_003548084.1| PREDICTED: uncharacterized protein LOC100789610 [Glycine max] Length = 192 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEK 124 +TP W K L + PPWILAC VIVFTRMRKRT+ FL+K Sbjct: 149 DTPNWLKKLNFSGVNFPPWILACVVIVFTRMRKRTRDFLKK 189 >ref|XP_002300894.1| hypothetical protein POPTR_0002s06300g [Populus trichocarpa] gi|222842620|gb|EEE80167.1| hypothetical protein POPTR_0002s06300g [Populus trichocarpa] Length = 186 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/41 (65%), Positives = 28/41 (68%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEK 124 E P W K G PPWILACAVIVFTRMRKRT FL+K Sbjct: 143 ERPEWFKSSNLFGGSFPPWILACAVIVFTRMRKRTGDFLKK 183 >ref|XP_007151934.1| hypothetical protein PHAVU_004G088200g [Phaseolus vulgaris] gi|561025243|gb|ESW23928.1| hypothetical protein PHAVU_004G088200g [Phaseolus vulgaris] Length = 193 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEK 124 + P W K L + PPWILAC VIVFTRMRKRTK FL+K Sbjct: 150 DPPDWLKKLNFSGVNFPPWILACVVIVFTRMRKRTKDFLKK 190 >ref|XP_004489905.1| PREDICTED: uncharacterized protein LOC101498334 [Cicer arietinum] Length = 185 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/41 (63%), Positives = 28/41 (68%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEK 124 +TP W K L + PWILAC VIVFTRMRKRTK FL K Sbjct: 142 DTPEWMKKLNFSSMNFSPWILACVVIVFTRMRKRTKDFLTK 182 >ref|XP_002264853.1| PREDICTED: uncharacterized protein LOC100254523 [Vitis vinifera] gi|297739355|emb|CBI29345.3| unnamed protein product [Vitis vinifera] Length = 186 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEKF 127 E P K L + G PPW+LACAVIVFTRMRKRTK L+K+ Sbjct: 141 EPPELIKKLYISGGNFPPWVLACAVIVFTRMRKRTKDMLKKY 182 >ref|NP_565024.1| uncharacterized protein [Arabidopsis thaliana] gi|332197111|gb|AEE35232.1| uncharacterized protein AT1G71780 [Arabidopsis thaliana] Length = 197 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEKF 127 + PAW K+ +IG PPW+LAC VIVFTR RKRT+ F +K+ Sbjct: 155 DPPAWIKN-NISIGTFPPWVLACIVIVFTRARKRTRDFFKKY 195 >gb|AAF43231.1|AC012654_15 EST gb|Z37689 comes from this gene [Arabidopsis thaliana] gi|21554410|gb|AAM63515.1| unknown [Arabidopsis thaliana] Length = 194 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEKF 127 + PAW K+ +IG PPW+LAC VIVFTR RKRT+ F +K+ Sbjct: 152 DPPAWIKN-NISIGTFPPWVLACIVIVFTRARKRTRDFFKKY 192 >ref|XP_002888847.1| hypothetical protein ARALYDRAFT_476299 [Arabidopsis lyrata subsp. lyrata] gi|297334688|gb|EFH65106.1| hypothetical protein ARALYDRAFT_476299 [Arabidopsis lyrata subsp. lyrata] Length = 190 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +2 Query: 2 ETPAWAKDLQSTIGPVPPWILACAVIVFTRMRKRTKSFLEKF 127 + PAW K+ S IG PPW+LAC VIVFTR RKRT+ F +K+ Sbjct: 148 DPPAWIKNNVS-IGTFPPWVLACIVIVFTRARKRTRDFFKKY 188