BLASTX nr result
ID: Mentha24_contig00025337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00025337 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30946.1| hypothetical protein MIMGU_mgv1a004116mg [Mimulus... 75 9e-12 >gb|EYU30946.1| hypothetical protein MIMGU_mgv1a004116mg [Mimulus guttatus] Length = 543 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/73 (54%), Positives = 47/73 (64%), Gaps = 2/73 (2%) Frame = +2 Query: 161 HEY--RKSEIHNGKETRSMTTSMGSGNSQKMHTNAGSPHVISLETEGVRVLSESTGKGLK 334 HEY +S+ N KETRSMTT+ SGN QK+ S H IS E E L++ST KGLK Sbjct: 5 HEYWENESKFRNSKETRSMTTNKSSGNCQKLPIKTVSSHAISSEIEDASNLTQSTSKGLK 64 Query: 335 TSVRKLAQHFRGP 373 TSVRK Q+FR P Sbjct: 65 TSVRKFVQNFRAP 77