BLASTX nr result
ID: Mentha24_contig00025220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00025220 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33164.1| hypothetical protein MIMGU_mgv1a004218mg [Mimulus... 50 3e-09 ref|XP_004236780.1| PREDICTED: serine/threonine-protein phosphat... 43 1e-08 ref|XP_006361409.1| PREDICTED: probable serine/threonine protein... 42 5e-08 gb|EYU19894.1| hypothetical protein MIMGU_mgv1a004196mg [Mimulus... 44 8e-08 gb|EPS71483.1| hypothetical protein M569_03272, partial [Genlise... 44 1e-07 gb|EPS71035.1| hypothetical protein M569_03725 [Genlisea aurea] 42 1e-06 >gb|EYU33164.1| hypothetical protein MIMGU_mgv1a004218mg [Mimulus guttatus] Length = 539 Score = 50.1 bits (118), Expect(2) = 3e-09 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +2 Query: 170 MDLDFNGDVTCLDAELLQLQEVSP 241 MDLDFNGDVTCLDAELLQL EVSP Sbjct: 1 MDLDFNGDVTCLDAELLQLPEVSP 24 Score = 36.6 bits (83), Expect(2) = 3e-09 Identities = 17/29 (58%), Positives = 23/29 (79%), Gaps = 1/29 (3%) Frame = +1 Query: 286 GGGPVNAAGTAS-TNTVASNTLPSMFPAG 369 GG P++ +GT+S TN+ SN+LPSMF AG Sbjct: 60 GGSPLHVSGTSSSTNSAPSNSLPSMFAAG 88 >ref|XP_004236780.1| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha-like [Solanum lycopersicum] Length = 539 Score = 42.7 bits (99), Expect(2) = 1e-08 Identities = 20/29 (68%), Positives = 25/29 (86%), Gaps = 1/29 (3%) Frame = +1 Query: 286 GGGPVNAAGTAS-TNTVASNTLPSMFPAG 369 GGGP+N + T+S TN VA+N+LPSMFPAG Sbjct: 60 GGGPLNVSTTSSGTNVVATNSLPSMFPAG 88 Score = 42.0 bits (97), Expect(2) = 1e-08 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = +2 Query: 170 MDLDFNGDVTCLDAELLQLQEVSP 241 MD+DFNGDV LDAELLQL E+SP Sbjct: 1 MDVDFNGDVASLDAELLQLPELSP 24 >ref|XP_006361409.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma-like [Solanum tuberosum] Length = 539 Score = 42.0 bits (97), Expect(2) = 5e-08 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = +2 Query: 170 MDLDFNGDVTCLDAELLQLQEVSP 241 MD+DFNGDV LDAELLQL E+SP Sbjct: 1 MDVDFNGDVASLDAELLQLPELSP 24 Score = 40.8 bits (94), Expect(2) = 5e-08 Identities = 19/29 (65%), Positives = 24/29 (82%), Gaps = 1/29 (3%) Frame = +1 Query: 286 GGGPVNAAGTAS-TNTVASNTLPSMFPAG 369 GGGP+N + T+S TN A+N+LPSMFPAG Sbjct: 60 GGGPLNMSTTSSGTNVAATNSLPSMFPAG 88 >gb|EYU19894.1| hypothetical protein MIMGU_mgv1a004196mg [Mimulus guttatus] Length = 539 Score = 44.3 bits (103), Expect(2) = 8e-08 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = +2 Query: 170 MDLDFNGDVTCLDAELLQLQEVSP 241 MDLDFNGDV LDAELLQL EVSP Sbjct: 1 MDLDFNGDVASLDAELLQLPEVSP 24 Score = 37.7 bits (86), Expect(2) = 8e-08 Identities = 18/28 (64%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = +1 Query: 286 GGGPVNAAGTAST-NTVASNTLPSMFPA 366 GGG +N +GT+S+ ASNTLPSMFPA Sbjct: 60 GGGSLNVSGTSSSAGAAASNTLPSMFPA 87 >gb|EPS71483.1| hypothetical protein M569_03272, partial [Genlisea aurea] Length = 551 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = +2 Query: 134 CFVN*GDLREIEMDLDFNGDVTCLDAELLQLQEVSP 241 CF N DL + MDLDFNGDV DAELLQL EVSP Sbjct: 4 CF-NLSDL--LVMDLDFNGDVASFDAELLQLPEVSP 36 Score = 38.1 bits (87), Expect(2) = 1e-07 Identities = 18/28 (64%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = +1 Query: 289 GGPVNAAGTASTNTVASN-TLPSMFPAG 369 GGP+NA GT++ T SN +LPSMFPAG Sbjct: 73 GGPLNATGTSTCTTPGSNSSLPSMFPAG 100 >gb|EPS71035.1| hypothetical protein M569_03725 [Genlisea aurea] Length = 539 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = +2 Query: 170 MDLDFNGDVTCLDAELLQLQEVSP 241 MDLDFNGDV DAELLQ+ EVSP Sbjct: 1 MDLDFNGDVPSFDAELLQIPEVSP 24 Score = 36.2 bits (82), Expect(2) = 1e-06 Identities = 16/29 (55%), Positives = 24/29 (82%), Gaps = 2/29 (6%) Frame = +1 Query: 289 GGPVNAAGTASTNTV--ASNTLPSMFPAG 369 GGP+N +G +S++T A+++LPSMFPAG Sbjct: 61 GGPLNVSGNSSSSTTSGANSSLPSMFPAG 89