BLASTX nr result
ID: Mentha24_contig00025017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00025017 (607 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22815.1| hypothetical protein MIMGU_mgv1a006425mg [Mimulus... 56 7e-06 >gb|EYU22815.1| hypothetical protein MIMGU_mgv1a006425mg [Mimulus guttatus] Length = 444 Score = 56.2 bits (134), Expect = 7e-06 Identities = 33/68 (48%), Positives = 37/68 (54%), Gaps = 3/68 (4%) Frame = -1 Query: 319 MEAHAQKQGG---SSNSGHREPPPSSLQLVSHTHHHQSQPEXXXXXXXXXPNGPFMGSIS 149 ME + + QGG SSNS H Q H HH+QSQ E +GPFMGSIS Sbjct: 4 MEPNNKNQGGGGNSSNSDHHHEHHQHHQQHHHHHHNQSQTEPGSGSGPTPLHGPFMGSIS 63 Query: 148 MQQPRNLA 125 MQQ RNLA Sbjct: 64 MQQSRNLA 71