BLASTX nr result
ID: Mentha24_contig00024887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00024887 (578 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28014.1| hypothetical protein MIMGU_mgv1a006360mg [Mimulus... 78 2e-12 gb|EPS71186.1| hypothetical protein M569_03572, partial [Genlise... 74 3e-11 ref|XP_007135119.1| hypothetical protein PHAVU_010G102600g [Phas... 74 4e-11 ref|XP_006594568.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_007212834.1| hypothetical protein PRUPE_ppa020757mg [Prun... 70 4e-10 ref|XP_006377412.1| pentatricopeptide repeat-containing family p... 70 4e-10 ref|XP_004146658.1| PREDICTED: pentatricopeptide repeat-containi... 70 5e-10 ref|XP_006364306.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_004233837.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_004485837.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 gb|ABN08713.1| Pentatricopeptide repeat [Medicago truncatula] 68 2e-09 ref|XP_002523058.1| pentatricopeptide repeat-containing protein,... 67 3e-09 ref|XP_006279616.1| hypothetical protein CARUB_v10026337mg [Caps... 67 3e-09 ref|XP_004293839.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_007025536.1| Pentatricopeptide repeat (PPR) superfamily p... 66 6e-09 ref|XP_007025535.1| Pentatricopeptide repeat (PPR) superfamily p... 66 6e-09 ref|XP_004296456.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_002863429.1| pentatricopeptide repeat-containing protein ... 65 1e-08 ref|NP_199422.1| pentatricopeptide repeat-containing protein [Ar... 64 2e-08 ref|XP_006398290.1| hypothetical protein EUTSA_v10000872mg [Eutr... 64 3e-08 >gb|EYU28014.1| hypothetical protein MIMGU_mgv1a006360mg [Mimulus guttatus] Length = 447 Score = 77.8 bits (190), Expect = 2e-12 Identities = 33/49 (67%), Positives = 44/49 (89%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MG+K + KWPKQITP LVE L+ +E+DL++A+S+F++ATAEYSNGFRHD Sbjct: 1 MGSKSVTKWPKQITPSLVEGLIYSERDLDKAISIFDAATAEYSNGFRHD 49 >gb|EPS71186.1| hypothetical protein M569_03572, partial [Genlisea aurea] Length = 472 Score = 73.9 bits (180), Expect = 3e-11 Identities = 31/43 (72%), Positives = 42/43 (97%) Frame = -2 Query: 130 MKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MKWP++ITPPLV++L+ +EK+LE+AVS+F+SATAEYSNG+RHD Sbjct: 6 MKWPEKITPPLVQQLIRSEKNLEKAVSIFDSATAEYSNGYRHD 48 >ref|XP_007135119.1| hypothetical protein PHAVU_010G102600g [Phaseolus vulgaris] gi|593265884|ref|XP_007135120.1| hypothetical protein PHAVU_010G102600g [Phaseolus vulgaris] gi|561008164|gb|ESW07113.1| hypothetical protein PHAVU_010G102600g [Phaseolus vulgaris] gi|561008165|gb|ESW07114.1| hypothetical protein PHAVU_010G102600g [Phaseolus vulgaris] Length = 479 Score = 73.6 bits (179), Expect = 4e-11 Identities = 32/49 (65%), Positives = 43/49 (87%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MG+K + KWPKQIT LV +L+ AEKD+++AV++F++ATAEYSNGFRHD Sbjct: 1 MGSKTLFKWPKQITNSLVVQLIKAEKDVQKAVTIFDTATAEYSNGFRHD 49 >ref|XP_006594568.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like isoform X1 [Glycine max] Length = 479 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MG+K + KWPKQIT LV +L+ AEKD+ +AV++F+SATAEY NGFRHD Sbjct: 1 MGSKTLFKWPKQITNSLVVQLIKAEKDVHKAVNMFDSATAEYGNGFRHD 49 >ref|XP_007212834.1| hypothetical protein PRUPE_ppa020757mg [Prunus persica] gi|462408699|gb|EMJ14033.1| hypothetical protein PRUPE_ppa020757mg [Prunus persica] Length = 479 Score = 70.1 bits (170), Expect = 4e-10 Identities = 30/49 (61%), Positives = 41/49 (83%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MG+K + KW KQIT VE+L+ AEKD+++A+ +F+SATAEY+NGFRHD Sbjct: 1 MGSKTLFKWSKQITTSQVEQLIKAEKDIQKAILIFDSATAEYTNGFRHD 49 >ref|XP_006377412.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550327701|gb|ERP55209.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 478 Score = 70.1 bits (170), Expect = 4e-10 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MG K ++KW KQITP VE+L+ AE+DL +A +F+SA+AEYSNGFRHD Sbjct: 1 MGMKTLLKWSKQITPSKVEQLLRAERDLRKAKIIFDSASAEYSNGFRHD 49 >ref|XP_004146658.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Cucumis sativus] gi|449484609|ref|XP_004156929.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Cucumis sativus] Length = 501 Score = 69.7 bits (169), Expect = 5e-10 Identities = 33/71 (46%), Positives = 50/71 (70%) Frame = -2 Query: 214 KFILAQRLETVRRNASLRI*GKMGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESA 35 K + Q VR++ SL MG+K M KW K +TP V++L+ AE+D+++A+ +F+SA Sbjct: 8 KIHVLQVQSEVRQSDSLNKRRTMGSKAMFKWAKTVTPTHVQQLIQAERDIKKALIIFDSA 67 Query: 34 TAEYSNGFRHD 2 TAEY+NGF+HD Sbjct: 68 TAEYANGFKHD 78 >ref|XP_006364306.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like isoform X1 [Solanum tuberosum] gi|565397449|ref|XP_006364307.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like isoform X2 [Solanum tuberosum] Length = 479 Score = 69.3 bits (168), Expect = 7e-10 Identities = 29/49 (59%), Positives = 42/49 (85%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MG+K +KWP+++T VE+L+ AEKD+++AV +F++ATAEYSNGFRHD Sbjct: 1 MGSKIPIKWPREVTAAFVEQLIRAEKDVQKAVLIFDAATAEYSNGFRHD 49 >ref|XP_004233837.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Solanum lycopersicum] Length = 479 Score = 69.3 bits (168), Expect = 7e-10 Identities = 29/49 (59%), Positives = 42/49 (85%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MG+K +KWP+++T VE+L+ AEKD+++AV +F++ATAEYSNGFRHD Sbjct: 1 MGSKIPIKWPREVTAAFVEQLIRAEKDVQKAVLIFDAATAEYSNGFRHD 49 >ref|XP_004485837.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Cicer arietinum] Length = 479 Score = 68.9 bits (167), Expect = 9e-10 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 M +K + KWPKQIT LVE+L+ AEKD+ +A+ +F+SATAEY+NGF HD Sbjct: 1 MASKTLFKWPKQITNSLVEQLIKAEKDIHKAILMFDSATAEYTNGFSHD 49 >gb|ABN08713.1| Pentatricopeptide repeat [Medicago truncatula] Length = 479 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 M +K + KWPKQIT LVE+L+ AEKD+ + + +F+SAT EYSNGFRHD Sbjct: 1 MASKTLFKWPKQITNSLVEQLIKAEKDINKTLVMFDSATEEYSNGFRHD 49 >ref|XP_002523058.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537620|gb|EEF39243.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 286 Score = 67.4 bits (163), Expect = 3e-09 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 M TK + KW K+ITP VE+++ AEKD+E+A VF+SATAEYS+GF+HD Sbjct: 1 MATKTLFKWSKKITPSQVEQVIRAEKDIEKAKLVFDSATAEYSHGFKHD 49 >ref|XP_006279616.1| hypothetical protein CARUB_v10026337mg [Capsella rubella] gi|482548320|gb|EOA12514.1| hypothetical protein CARUB_v10026337mg [Capsella rubella] Length = 472 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -2 Query: 148 MGTKPM-MKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MGTK M KW K ITP V +LM AEKD+E++++VF+SATAEY+NGF HD Sbjct: 1 MGTKAMTFKWSKNITPSQVIKLMRAEKDVEKSIAVFDSATAEYANGFSHD 50 >ref|XP_004293839.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Fragaria vesca subsp. vesca] Length = 476 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MG+K + KW KQIT V +L+ AEKDL++A+ +F+SATAEY+NGFRHD Sbjct: 1 MGSKTLFKWSKQITSLQVGQLIKAEKDLQKALIIFDSATAEYTNGFRHD 49 >ref|XP_007025536.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] gi|590624193|ref|XP_007025537.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] gi|508780902|gb|EOY28158.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] gi|508780903|gb|EOY28159.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] Length = 487 Score = 66.2 bits (160), Expect = 6e-09 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MGTK KW K+ITP V L+ AEK+++ A+++F+SATAEY+NGFRHD Sbjct: 2 MGTKVAFKWSKKITPSQVVHLIKAEKNIDEALAIFDSATAEYTNGFRHD 50 >ref|XP_007025535.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|508780901|gb|EOY28157.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] Length = 492 Score = 66.2 bits (160), Expect = 6e-09 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MGTK KW K+ITP V L+ AEK+++ A+++F+SATAEY+NGFRHD Sbjct: 2 MGTKVAFKWSKKITPSQVVHLIKAEKNIDEALAIFDSATAEYTNGFRHD 50 >ref|XP_004296456.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Fragaria vesca subsp. vesca] Length = 477 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = -2 Query: 148 MGTKPMMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MG+K + KW KQIT V +L+ +EKDL++A+ +F+SATAEY+NGFRHD Sbjct: 1 MGSKTLFKWSKQITCSQVGQLIKSEKDLQKALIIFDSATAEYTNGFRHD 49 >ref|XP_002863429.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297309264|gb|EFH39688.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 472 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -2 Query: 148 MGTKPMM-KWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MG+K MM KW K ITP V +LM AEKD+E++++VF+SATAEY+NG+ HD Sbjct: 1 MGSKMMMFKWSKNITPSQVIKLMRAEKDVEKSIAVFDSATAEYANGYLHD 50 >ref|NP_199422.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171880|sp|Q9FNL2.1|PP418_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g46100 gi|9757730|dbj|BAB08255.1| salt-inducible protein-like [Arabidopsis thaliana] gi|332007954|gb|AED95337.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 472 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -2 Query: 148 MGTKPMM-KWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MG+K MM KW K ITP V +LM AEKD+E++++VF+SATAEY+NG+ HD Sbjct: 1 MGSKVMMFKWSKNITPSQVIKLMRAEKDVEKSMAVFDSATAEYANGYVHD 50 >ref|XP_006398290.1| hypothetical protein EUTSA_v10000872mg [Eutrema salsugineum] gi|557099379|gb|ESQ39743.1| hypothetical protein EUTSA_v10000872mg [Eutrema salsugineum] Length = 472 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -2 Query: 148 MGTKP-MMKWPKQITPPLVERLMLAEKDLERAVSVFESATAEYSNGFRHD 2 MG+K M KW K ITP V +LM AEKD+E+ ++VF+SATAEY+NGF HD Sbjct: 1 MGSKEKMFKWSKTITPSQVIKLMRAEKDVEKLIAVFDSATAEYANGFLHD 50