BLASTX nr result
ID: Mentha24_contig00024871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00024871 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27528.1| hypothetical protein MIMGU_mgv1a007002mg [Mimulus... 73 5e-11 >gb|EYU27528.1| hypothetical protein MIMGU_mgv1a007002mg [Mimulus guttatus] Length = 423 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -2 Query: 375 FLKENPLVSEEIEKKVRVALTEGSGPIGSFAKSSSPNSDEEDVFQEMQ 232 +LKENPLVSEEIEKKVR A+TEG G GS+AK S+P +D ED+FQEMQ Sbjct: 376 YLKENPLVSEEIEKKVRAAVTEGIGNGGSYAKPSAPQTDSEDMFQEMQ 423