BLASTX nr result
ID: Mentha24_contig00024758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00024758 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22647.1| hypothetical protein MIMGU_mgv1a020171mg, partial... 48 2e-06 >gb|EYU22647.1| hypothetical protein MIMGU_mgv1a020171mg, partial [Mimulus guttatus] Length = 370 Score = 48.1 bits (113), Expect(2) = 2e-06 Identities = 26/46 (56%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Frame = +1 Query: 262 PKVKRRWSFKRPPTARP--ITHKSSLSFDSIYMPKQA-LLDYEHEH 390 PK +RRWSFKR + +P THKSS SFDSI KQA L+Y+ H Sbjct: 49 PKERRRWSFKRSTSTKPNARTHKSSRSFDSILASKQASFLEYQAHH 94 Score = 29.3 bits (64), Expect(2) = 2e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 174 MGKAGKWIRNLLM 212 MGKA KWIRNLLM Sbjct: 1 MGKASKWIRNLLM 13