BLASTX nr result
ID: Mentha24_contig00024643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00024643 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17465.1| hypothetical protein MIMGU_mgv1a007576mg [Mimulus... 99 6e-19 >gb|EYU17465.1| hypothetical protein MIMGU_mgv1a007576mg [Mimulus guttatus] Length = 403 Score = 99.0 bits (245), Expect = 6e-19 Identities = 52/95 (54%), Positives = 65/95 (68%), Gaps = 1/95 (1%) Frame = -3 Query: 283 MESSTRNALILLSPNSHTLNDFNSSFNHLSTLISSSAPHAYTSNPTAAHKVFAKIPKPKL 104 ME+ +R +LILLSPNSHTL DFNS+FNHL+TLIS+ PH++T N K +L Sbjct: 1 METPSRKSLILLSPNSHTLTDFNSTFNHLNTLISTPIPHSFTPNR----------KKNRL 50 Query: 103 SFSSTTVSNQEPLQNPQK-HNWFKPAARGSPAAQA 2 +FSSTT+SN E + +K NW KPA RGSPA A Sbjct: 51 NFSSTTISNHEHTKPSEKPRNWLKPATRGSPAVHA 85