BLASTX nr result
ID: Mentha24_contig00024538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00024538 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46210.1| hypothetical protein MIMGU_mgv1a008386mg [Mimulus... 82 1e-13 ref|XP_006446248.1| hypothetical protein CICLE_v10015553mg [Citr... 60 2e-07 >gb|EYU46210.1| hypothetical protein MIMGU_mgv1a008386mg [Mimulus guttatus] Length = 375 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -3 Query: 139 EDFFDRLPDDVVLSIFVKLQDARSLCLSMAACKRFRSIAPQVDRIF 2 +D FDRLPD+VVLSIF KLQDARSLCLSMAACKRFRSIAPQV IF Sbjct: 18 DDSFDRLPDEVVLSIFEKLQDARSLCLSMAACKRFRSIAPQVGEIF 63 >ref|XP_006446248.1| hypothetical protein CICLE_v10015553mg [Citrus clementina] gi|557548859|gb|ESR59488.1| hypothetical protein CICLE_v10015553mg [Citrus clementina] Length = 389 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/73 (39%), Positives = 45/73 (61%), Gaps = 4/73 (5%) Frame = -3 Query: 208 FDFHSSQTPKSTMNSSSEQILHSE----DFFDRLPDDVVLSIFVKLQDARSLCLSMAACK 41 F++ ++ P N+ E+I+ E D+FD LPD ++L IF KL DA+SL + CK Sbjct: 30 FEYSQAKQPIKRKNNQMERIVLQEEKADDYFDSLPDAILLDIFNKLLDAKSLTRCLVVCK 89 Query: 40 RFRSIAPQVDRIF 2 RF S+ PQ++ +F Sbjct: 90 RFSSLIPQINNLF 102