BLASTX nr result
ID: Mentha24_contig00024304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00024304 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22964.1| hypothetical protein MIMGU_mgv1a007566mg [Mimulus... 57 2e-06 ref|XP_006357670.1| PREDICTED: U-box domain-containing protein 3... 56 5e-06 ref|XP_004243591.1| PREDICTED: U-box domain-containing protein 3... 56 5e-06 >gb|EYU22964.1| hypothetical protein MIMGU_mgv1a007566mg [Mimulus guttatus] Length = 403 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 3 YKFAAKVDGKDKAVETAKKLLQDMVQKSMDLSINRTKLR 119 Y FAA++DG DKAVETAK+LLQDMVQKS++L+ +R K R Sbjct: 356 YDFAAQIDGTDKAVETAKRLLQDMVQKSVELNTSRAKNR 394 >ref|XP_006357670.1| PREDICTED: U-box domain-containing protein 3-like [Solanum tuberosum] Length = 393 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +3 Query: 3 YKFAAKVDGKDKAVETAKKLLQDMVQKSMDLSINRTKLR 119 Y FAA+VDG DKA +TAK+LLQDMV +SM+LS++R +LR Sbjct: 343 YDFAAQVDGTDKAADTAKRLLQDMVHRSMELSMSRLQLR 381 >ref|XP_004243591.1| PREDICTED: U-box domain-containing protein 3-like [Solanum lycopersicum] Length = 394 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +3 Query: 3 YKFAAKVDGKDKAVETAKKLLQDMVQKSMDLSINRTKLR 119 Y FAA+VDG DKA +TAK+LLQDMV +SM+LS++R +LR Sbjct: 344 YDFAAQVDGTDKAADTAKRLLQDMVHRSMELSMSRLQLR 382