BLASTX nr result
ID: Mentha24_contig00023822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00023822 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21003.1| hypothetical protein MIMGU_mgv1a013248mg [Mimulus... 76 5e-12 >gb|EYU21003.1| hypothetical protein MIMGU_mgv1a013248mg [Mimulus guttatus] gi|604301309|gb|EYU21004.1| hypothetical protein MIMGU_mgv1a013248mg [Mimulus guttatus] Length = 226 Score = 75.9 bits (185), Expect = 5e-12 Identities = 45/65 (69%), Positives = 49/65 (75%), Gaps = 3/65 (4%) Frame = +1 Query: 130 MEEAKVVDGKDGT---SAAFTAHQEVVEVEAKDGDISVPTAFSGHQEVVEAKDGTISVAS 300 ME A VVD K G+ ++ FTA QEVVE AKDG ISV + SGHQEVVEAKDGTISVAS Sbjct: 1 MEAANVVDVKGGSVPLTSVFTADQEVVE--AKDGIISVASTCSGHQEVVEAKDGTISVAS 58 Query: 301 AFPGH 315 AF GH Sbjct: 59 AFAGH 63