BLASTX nr result
ID: Mentha24_contig00023762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00023762 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQ10675.1| type-A response regulator [Catharanthus roseus] 70 4e-10 ref|NP_177627.1| two-component response regulator ARR15 [Arabido... 68 2e-09 ref|XP_006483757.1| PREDICTED: two-component response regulator ... 67 3e-09 dbj|BAM74645.1| type-A response regulator [Torenia fournieri] 66 4e-09 ref|XP_002888998.1| hypothetical protein ARALYDRAFT_316423 [Arab... 66 4e-09 ref|XP_002511471.1| two-component sensor protein histidine prote... 66 4e-09 ref|XP_004299595.1| PREDICTED: two-component response regulator ... 65 1e-08 ref|XP_007044474.1| Two-component response regulator ARR4 [Theob... 64 2e-08 ref|XP_006438504.1| hypothetical protein CICLE_v10032281mg [Citr... 64 3e-08 ref|XP_006438503.1| hypothetical protein CICLE_v10032281mg [Citr... 64 3e-08 ref|XP_002322145.2| hypothetical protein POPTR_0015s08130g [Popu... 63 5e-08 ref|XP_007223876.1| hypothetical protein PRUPE_ppa010863mg [Prun... 63 5e-08 ref|XP_004236156.1| PREDICTED: two-component response regulator ... 63 5e-08 ref|XP_002322144.1| hypothetical protein POPTR_0015s08130g [Popu... 63 5e-08 ref|XP_004297679.1| PREDICTED: two-component response regulator ... 62 6e-08 ref|XP_003613423.1| Two-component response regulator ARR3 [Medic... 62 6e-08 ref|XP_006600658.1| PREDICTED: two-component response regulator ... 62 8e-08 ref|XP_007155382.1| hypothetical protein PHAVU_003G196500g [Phas... 62 8e-08 ref|XP_002312699.2| hypothetical protein POPTR_0008s19730g [Popu... 62 8e-08 ref|XP_003549646.1| PREDICTED: two-component response regulator ... 62 8e-08 >gb|AAQ10675.1| type-A response regulator [Catharanthus roseus] Length = 254 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +3 Query: 183 CSSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 CSS +E HVLAVDDS++DRKVIERLLKISCCKVTAV+S Sbjct: 6 CSSGSAKELHVLAVDDSLVDRKVIERLLKISCCKVTAVES 45 >ref|NP_177627.1| two-component response regulator ARR15 [Arabidopsis thaliana] gi|51315904|sp|Q7G8V2.1|ARR15_ARATH RecName: Full=Two-component response regulator ARR15 gi|5882734|gb|AAD55287.1|AC008263_18 Similar to gb|AB008490 response regulator 7 (ARR7) from Arabidopsis thaliana. EST gb|AA042183 comes from this gene [Arabidopsis thaliana] gi|11870065|gb|AAG40611.1|AF305720_1 response regulator 15 [Arabidopsis thaliana] gi|12323888|gb|AAG51914.1|AC013258_8 putative response regulator (two component phosphotransfer signaling); 70657-71777 [Arabidopsis thaliana] gi|332197523|gb|AEE35644.1| two-component response regulator ARR15 [Arabidopsis thaliana] Length = 206 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/49 (69%), Positives = 37/49 (75%) Frame = +3 Query: 156 MAVEDFGSDCSSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 MA+ D S SSS E HVLAVDDS +DRKVIERLLKIS CKVT V+S Sbjct: 1 MALRDLSSSLSSSSSPELHVLAVDDSFVDRKVIERLLKISACKVTTVES 49 >ref|XP_006483757.1| PREDICTED: two-component response regulator ARR4-like [Citrus sinensis] Length = 233 Score = 66.6 bits (161), Expect = 3e-09 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = +3 Query: 135 GKAQIKKMAVEDFGSDCSSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 G A ++ ++ E G D S S +E HVLAVDDS +DRKVIERLL IS CKVTAVDS Sbjct: 6 GVASLRLISDEIDGFDLSPSDTEEVHVLAVDDSFVDRKVIERLLTISSCKVTAVDS 61 >dbj|BAM74645.1| type-A response regulator [Torenia fournieri] Length = 213 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/42 (78%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = +3 Query: 180 DCSSSGV-QEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 DCSSS + QEFHVLAVDDS++DRKVIE+L KIS CKVTAV+S Sbjct: 5 DCSSSDLNQEFHVLAVDDSLVDRKVIEKLFKISSCKVTAVES 46 >ref|XP_002888998.1| hypothetical protein ARALYDRAFT_316423 [Arabidopsis lyrata subsp. lyrata] gi|297334839|gb|EFH65257.1| hypothetical protein ARALYDRAFT_316423 [Arabidopsis lyrata subsp. lyrata] Length = 206 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = +3 Query: 156 MAVEDFGSDCSSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 MA+ + S SSS E HVLAVDDS +DRKVIERLLKIS CKVT V+S Sbjct: 1 MALREIASSSSSSSSPELHVLAVDDSFVDRKVIERLLKISACKVTTVES 49 >ref|XP_002511471.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] gi|223550586|gb|EEF52073.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] Length = 221 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +3 Query: 186 SSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 SS+G +E HVLAVDDS++DRKVIERLLKIS CKVTAVDS Sbjct: 20 SSNGSEELHVLAVDDSLVDRKVIERLLKISSCKVTAVDS 58 >ref|XP_004299595.1| PREDICTED: two-component response regulator ARR5-like [Fragaria vesca subsp. vesca] Length = 228 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 201 QEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 +E HVLAVDDSIIDRKVIE+LLKISCCKVTAVDS Sbjct: 21 KELHVLAVDDSIIDRKVIEKLLKISCCKVTAVDS 54 >ref|XP_007044474.1| Two-component response regulator ARR4 [Theobroma cacao] gi|508708409|gb|EOY00306.1| Two-component response regulator ARR4 [Theobroma cacao] Length = 394 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/67 (53%), Positives = 42/67 (62%) Frame = +3 Query: 102 FFFEAANKGVCGKAQIKKMAVEDFGSDCSSSGVQEFHVLAVDDSIIDRKVIERLLKISCC 281 FFF G ++ + G D S S +E HVLAVDDS +DRKVIERLL+IS C Sbjct: 151 FFFYYLEMARNGAVTWRRRTEKIDGFDLSPSDSEEVHVLAVDDSHVDRKVIERLLRISSC 210 Query: 282 KVTAVDS 302 KVTAVDS Sbjct: 211 KVTAVDS 217 >ref|XP_006438504.1| hypothetical protein CICLE_v10032281mg [Citrus clementina] gi|557540700|gb|ESR51744.1| hypothetical protein CICLE_v10032281mg [Citrus clementina] Length = 249 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = +3 Query: 174 GSDCSSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 G D S S +E HVLAVDDS +DRKVIERLL IS CKVTAVDS Sbjct: 35 GFDLSPSDTEEVHVLAVDDSFVDRKVIERLLTISSCKVTAVDS 77 >ref|XP_006438503.1| hypothetical protein CICLE_v10032281mg [Citrus clementina] gi|557540699|gb|ESR51743.1| hypothetical protein CICLE_v10032281mg [Citrus clementina] Length = 292 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = +3 Query: 174 GSDCSSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 G D S S +E HVLAVDDS +DRKVIERLL IS CKVTAVDS Sbjct: 35 GFDLSPSDTEEVHVLAVDDSFVDRKVIERLLTISSCKVTAVDS 77 >ref|XP_002322145.2| hypothetical protein POPTR_0015s08130g [Populus trichocarpa] gi|550322289|gb|EEF06272.2| hypothetical protein POPTR_0015s08130g [Populus trichocarpa] Length = 224 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +3 Query: 147 IKKMAVEDFG-SDCSSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 +++ E+ G S S SG +E HVLAVDDS +DRKVIERLLKIS CKVT V+S Sbjct: 8 LRRSLTEEVGFSKGSVSGSEELHVLAVDDSFVDRKVIERLLKISSCKVTVVES 60 >ref|XP_007223876.1| hypothetical protein PRUPE_ppa010863mg [Prunus persica] gi|462420812|gb|EMJ25075.1| hypothetical protein PRUPE_ppa010863mg [Prunus persica] Length = 232 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 174 GSDCSSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 G D S +E HVLAVDDS++DRKVIERLL+IS CKVTAVDS Sbjct: 18 GFDMSPMNSEEAHVLAVDDSLVDRKVIERLLRISSCKVTAVDS 60 >ref|XP_004236156.1| PREDICTED: two-component response regulator ARR6-like [Solanum lycopersicum] Length = 195 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 201 QEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 QE HVLAVDDS +DRKVIERLLKISCCKVTAV+S Sbjct: 5 QELHVLAVDDSHVDRKVIERLLKISCCKVTAVES 38 >ref|XP_002322144.1| hypothetical protein POPTR_0015s08130g [Populus trichocarpa] gi|222869140|gb|EEF06271.1| hypothetical protein POPTR_0015s08130g [Populus trichocarpa] gi|309951242|emb|CBX43991.1| putative A-type response regulator 10 [Populus x canadensis] Length = 223 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +3 Query: 147 IKKMAVEDFG-SDCSSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 +++ E+ G S S SG +E HVLAVDDS +DRKVIERLLKIS CKVT V+S Sbjct: 8 LRRSLTEEVGFSKGSVSGSEELHVLAVDDSFVDRKVIERLLKISSCKVTVVES 60 >ref|XP_004297679.1| PREDICTED: two-component response regulator ARR3-like [Fragaria vesca subsp. vesca] Length = 240 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +3 Query: 174 GSDCSSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 G D SSS +E HVLAVDDS++DRKVIERLL+IS CKVTAVDS Sbjct: 18 GLDLSSS--EEAHVLAVDDSLVDRKVIERLLRISSCKVTAVDS 58 >ref|XP_003613423.1| Two-component response regulator ARR3 [Medicago truncatula] gi|355514758|gb|AES96381.1| Two-component response regulator ARR3 [Medicago truncatula] Length = 237 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 201 QEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 QE HVLAVDDS++DRKVIERLLKIS CKVTAVDS Sbjct: 14 QEVHVLAVDDSLVDRKVIERLLKISACKVTAVDS 47 >ref|XP_006600658.1| PREDICTED: two-component response regulator ARR15-like isoform X2 [Glycine max] Length = 207 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 186 SSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 S SG E HVLAVDDS++DRKVIERLLKIS CKVT V+S Sbjct: 19 SPSGAPELHVLAVDDSLVDRKVIERLLKISSCKVTVVES 57 >ref|XP_007155382.1| hypothetical protein PHAVU_003G196500g [Phaseolus vulgaris] gi|561028736|gb|ESW27376.1| hypothetical protein PHAVU_003G196500g [Phaseolus vulgaris] Length = 206 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 186 SSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 S SG E HVLAVDDS++DRKVIERLLKIS CKVT V+S Sbjct: 19 SPSGAPELHVLAVDDSLVDRKVIERLLKISSCKVTVVES 57 >ref|XP_002312699.2| hypothetical protein POPTR_0008s19730g [Populus trichocarpa] gi|550333486|gb|EEE90066.2| hypothetical protein POPTR_0008s19730g [Populus trichocarpa] Length = 247 Score = 62.0 bits (149), Expect = 8e-08 Identities = 35/63 (55%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = +3 Query: 117 ANKGVCGKAQIKKMAVEDFGSDCSSSGVQE-FHVLAVDDSIIDRKVIERLLKISCCKVTA 293 +N V + +KM D + +S +E HVLAVDDS +DRKVIERLLKIS CKVTA Sbjct: 3 SNSVVSNRWMSEKMNCLDLSPNSNSDNEEEEVHVLAVDDSFVDRKVIERLLKISSCKVTA 62 Query: 294 VDS 302 VDS Sbjct: 63 VDS 65 >ref|XP_003549646.1| PREDICTED: two-component response regulator ARR15-like isoformX1 [Glycine max] Length = 206 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +3 Query: 186 SSSGVQEFHVLAVDDSIIDRKVIERLLKISCCKVTAVDS 302 S SG E HVLAVDDS++DRKVIERLLKIS CKVT V+S Sbjct: 19 SPSGAPELHVLAVDDSLVDRKVIERLLKISSCKVTVVES 57