BLASTX nr result
ID: Mentha24_contig00023754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00023754 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45289.1| hypothetical protein MIMGU_mgv1a015457mg [Mimulus... 68 1e-09 ref|XP_002515684.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 >gb|EYU45289.1| hypothetical protein MIMGU_mgv1a015457mg [Mimulus guttatus] Length = 157 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 99 MERLPTDLFLKIFGWLDHQNLAAAQMVCRKWRD 1 ME+LPTDL+LKIF WLDHQNLAAAQ+VCRKWRD Sbjct: 1 MEKLPTDLYLKIFCWLDHQNLAAAQLVCRKWRD 33 >ref|XP_002515684.1| conserved hypothetical protein [Ricinus communis] gi|223545227|gb|EEF46736.1| conserved hypothetical protein [Ricinus communis] Length = 163 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 99 MERLPTDLFLKIFGWLDHQNLAAAQMVCRKWR 4 MERLP DL LKIF WLDHQNLA AQ VC+KW+ Sbjct: 1 MERLPVDLCLKIFSWLDHQNLATAQQVCKKWK 32