BLASTX nr result
ID: Mentha24_contig00023625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00023625 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30282.1| hypothetical protein MIMGU_mgv1a004150mg [Mimulus... 91 2e-16 >gb|EYU30282.1| hypothetical protein MIMGU_mgv1a004150mg [Mimulus guttatus] Length = 541 Score = 90.9 bits (224), Expect = 2e-16 Identities = 49/115 (42%), Positives = 69/115 (60%), Gaps = 4/115 (3%) Frame = +3 Query: 6 RTLENGFPSAVFIYFNFGFPPYWKDCDERFLGKDPLSKDLSRDKLVDQLSQQPESTNGVQ 185 RTLENGFPS VF +F FGFPPYWK+ E F+ K+ ++S + S Q + Q Sbjct: 177 RTLENGFPSDVFDHFRFGFPPYWKEYVENFMAKESSRNEVSGFNISKVQSPQSRTMEAEQ 236 Query: 186 PCVDCREEDFGSQGKSEAKGVRKSNQTKSLAIALPQRR----SVSGLQKESYSVG 338 P VD E+D GSQ K++ K RK+ + S A++ ++ S S ++K+SYSVG Sbjct: 237 PRVDNLEKDLGSQDKTDVKRQRKNKKKSSSAVSPTKKSNSVISCSTVEKDSYSVG 291