BLASTX nr result
ID: Mentha24_contig00023445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00023445 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41901.1| hypothetical protein MIMGU_mgv1a018103mg, partial... 56 6e-06 >gb|EYU41901.1| hypothetical protein MIMGU_mgv1a018103mg, partial [Mimulus guttatus] Length = 412 Score = 55.8 bits (133), Expect = 6e-06 Identities = 43/106 (40%), Positives = 62/106 (58%), Gaps = 7/106 (6%) Frame = +3 Query: 15 YMTSDLEVVSDSLR--HLDIRSRASRNTIKVSAPNLTWLTVDHHSGMVSLENVPKLVNMN 188 Y TS+LEV SLR HL+I S ++KVSAPNL LTV G++ LEN+P LV+++ Sbjct: 233 YKTSNLEVCGPSLRLKHLEIVSCFGLKSLKVSAPNLASLTVTSLKGLL-LENIPMLVDVS 291 Query: 189 FSCR--FEDTLHDFANAA---AQLETLIIMLYNAKVSFSVPEMPKL 311 FSC F F+ + +QLE L + + + + + E+PKL Sbjct: 292 FSCHDCFISVKRWFSQLSCCISQLEILCLDVTSLR-RYEWYELPKL 336