BLASTX nr result
ID: Mentha24_contig00023378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00023378 (648 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35084.1| hypothetical protein MIMGU_mgv1a011007mg [Mimulus... 62 2e-07 >gb|EYU35084.1| hypothetical protein MIMGU_mgv1a011007mg [Mimulus guttatus] Length = 295 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +3 Query: 543 GGSIFTGPGKLVPHIINVAVGEDIKRKVLSFAQGR 647 GGS+ GPGK+VPHIINVA GED+KRK+L+F+QGR Sbjct: 140 GGSVPNGPGKMVPHIINVATGEDVKRKILTFSQGR 174