BLASTX nr result
ID: Mentha24_contig00022305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00022305 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45976.1| hypothetical protein MIMGU_mgv1a004451mg [Mimulus... 88 1e-15 >gb|EYU45976.1| hypothetical protein MIMGU_mgv1a004451mg [Mimulus guttatus] Length = 526 Score = 88.2 bits (217), Expect = 1e-15 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 7/114 (6%) Frame = -3 Query: 322 ARCLLISLNSAPKPHLLRTTGKASFHSKSRPASFHLCPCERAHLHRIYDGIR---RVRWG 152 +R LLISL SAPK H + + +A+F S LCPC+RAH IY G RV+ G Sbjct: 4 SRALLISLYSAPKTHP-QISPRATFLPNSG-LLLQLCPCQRAHFRPIYVGNGLSWRVKSG 61 Query: 151 RLRAEVKSEQYDVVESVPESVGLDQV----LPPEDDGGGSVDAIALPWWEQFPK 2 R+RA+VKSE D+ ES P+SV +V + +DD G V + A+PWWEQFP+ Sbjct: 62 RVRADVKSEPCDIAESPPDSVQFGKVFATSIVDDDDDDGDVTSAAVPWWEQFPR 115