BLASTX nr result
ID: Mentha24_contig00022088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00022088 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29231.1| hypothetical protein MIMGU_mgv1a002140mg [Mimulus... 58 1e-06 gb|EYU29230.1| hypothetical protein MIMGU_mgv1a002072mg [Mimulus... 56 5e-06 >gb|EYU29231.1| hypothetical protein MIMGU_mgv1a002140mg [Mimulus guttatus] Length = 709 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 216 KMSKAKVLVFLDVSIDGDPYERMIFELFTDVA 311 K++K K+LVFLDVS+DGDP+ERMIFELFTDVA Sbjct: 3 KVNKRKLLVFLDVSVDGDPFERMIFELFTDVA 34 >gb|EYU29230.1| hypothetical protein MIMGU_mgv1a002072mg [Mimulus guttatus] Length = 719 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 216 KMSKAKVLVFLDVSIDGDPYERMIFELFTDVA 311 KMSK K LVF DVS+DGDP ERM+FELFTDVA Sbjct: 4 KMSKRKPLVFFDVSVDGDPLERMVFELFTDVA 35