BLASTX nr result
ID: Mentha24_contig00022005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00022005 (629 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 66 1e-08 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 65.9 bits (159), Expect = 1e-08 Identities = 45/131 (34%), Positives = 71/131 (54%), Gaps = 2/131 (1%) Frame = +3 Query: 39 VLSFDLGGETFDYFPVPPTAVSNAAY--ELLEYRGALGVIVYGLEVPRASFTEIWEWDHD 212 +LSFD+ E F P+P S A Y +LL++ G+LG IVY E S I W + Sbjct: 239 ILSFDMANEKFSTLPLPTFGGSLAQYYLQLLDFNGSLGAIVYPREGTEKS---IDLWVMN 295 Query: 213 QSCWNIFHTISLSHVDRPIGLWEDEFLFLEAKSSNFGDVMCKQIEVYALGTKNLRKLDIY 392 S F S+S V+RP+G W++ LFLE SSN ++ ++ T+ L+ L I+ Sbjct: 296 GSWTRQFSIESVSGVERPLGFWKNGELFLE--SSN------HELVLFDPATRELKNLGIH 347 Query: 393 SFSKKMKVLSY 425 ++ M++++Y Sbjct: 348 AYQNTMQLIAY 358