BLASTX nr result
ID: Mentha24_contig00021920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00021920 (421 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006451483.1| hypothetical protein CICLE_v10009610mg [Citr... 81 1e-13 ref|XP_007138722.1| hypothetical protein PHAVU_009G231900g [Phas... 80 4e-13 ref|XP_007012821.1| Translation initiation factor SUI1 family pr... 80 4e-13 ref|XP_007012820.1| Translation initiation factor SUI1 family pr... 80 4e-13 gb|EYU28402.1| hypothetical protein MIMGU_mgv1a014468mg [Mimulus... 79 5e-13 gb|EYU28401.1| hypothetical protein MIMGU_mgv1a014468mg [Mimulus... 79 5e-13 ref|XP_006587009.1| PREDICTED: translation machinery-associated ... 79 5e-13 ref|XP_003533754.1| PREDICTED: translation machinery-associated ... 79 5e-13 ref|XP_002309499.1| eukaryotic translation initiation factor SUI... 79 5e-13 gb|EXB38850.1| Density-regulated-like protein [Morus notabilis] 79 9e-13 ref|XP_004144004.1| PREDICTED: translation machinery-associated ... 78 1e-12 ref|XP_002324767.1| eukaryotic translation initiation factor SUI... 78 1e-12 ref|XP_007202618.1| hypothetical protein PRUPE_ppa011888mg [Prun... 78 1e-12 ref|NP_001235261.1| uncharacterized protein LOC100306708 [Glycin... 78 1e-12 ref|XP_004488049.1| PREDICTED: translation machinery-associated ... 77 2e-12 ref|XP_004968523.1| PREDICTED: translation machinery-associated ... 77 2e-12 tpg|DAA52988.1| TPA: hypothetical protein ZEAMMB73_597449 [Zea m... 77 2e-12 tpg|DAA52987.1| TPA: hypothetical protein ZEAMMB73_597449 [Zea m... 77 2e-12 gb|AFW80313.1| density-regulated protein [Zea mays] 77 2e-12 gb|AFK49317.1| unknown [Medicago truncatula] 77 2e-12 >ref|XP_006451483.1| hypothetical protein CICLE_v10009610mg [Citrus clementina] gi|568843105|ref|XP_006475462.1| PREDICTED: translation machinery-associated protein 22-like [Citrus sinensis] gi|557554709|gb|ESR64723.1| hypothetical protein CICLE_v10009610mg [Citrus clementina] Length = 188 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPAV 306 DVQGDI+YDIVEFITDTWPDVPETAIFFIEDGKKVPAV Sbjct: 151 DVQGDISYDIVEFITDTWPDVPETAIFFIEDGKKVPAV 188 >ref|XP_007138722.1| hypothetical protein PHAVU_009G231900g [Phaseolus vulgaris] gi|561011809|gb|ESW10716.1| hypothetical protein PHAVU_009G231900g [Phaseolus vulgaris] Length = 193 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDG+KVPA Sbjct: 156 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGRKVPA 192 >ref|XP_007012821.1| Translation initiation factor SUI1 family protein isoform 2 [Theobroma cacao] gi|508783184|gb|EOY30440.1| Translation initiation factor SUI1 family protein isoform 2 [Theobroma cacao] Length = 190 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDI+YDIVEFITDTWPDVPETAIFFIEDGKKVPA Sbjct: 153 DVQGDISYDIVEFITDTWPDVPETAIFFIEDGKKVPA 189 >ref|XP_007012820.1| Translation initiation factor SUI1 family protein isoform 1 [Theobroma cacao] gi|508783183|gb|EOY30439.1| Translation initiation factor SUI1 family protein isoform 1 [Theobroma cacao] Length = 191 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDI+YDIVEFITDTWPDVPETAIFFIEDGKKVPA Sbjct: 154 DVQGDISYDIVEFITDTWPDVPETAIFFIEDGKKVPA 190 >gb|EYU28402.1| hypothetical protein MIMGU_mgv1a014468mg [Mimulus guttatus] Length = 187 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPAV 306 DVQGDIAYDIVEFITDTWPDVPE+AIFFIE+GKKVPAV Sbjct: 150 DVQGDIAYDIVEFITDTWPDVPESAIFFIEEGKKVPAV 187 >gb|EYU28401.1| hypothetical protein MIMGU_mgv1a014468mg [Mimulus guttatus] Length = 188 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPAV 306 DVQGDIAYDIVEFITDTWPDVPE+AIFFIE+GKKVPAV Sbjct: 151 DVQGDIAYDIVEFITDTWPDVPESAIFFIEEGKKVPAV 188 >ref|XP_006587009.1| PREDICTED: translation machinery-associated protein 22-like isoform X2 [Glycine max] Length = 189 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDIAYD+VEFITDTWPDVPETAIFFIEDG+KVPA Sbjct: 152 DVQGDIAYDVVEFITDTWPDVPETAIFFIEDGRKVPA 188 >ref|XP_003533754.1| PREDICTED: translation machinery-associated protein 22-like isoformX1 [Glycine max] Length = 190 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDIAYD+VEFITDTWPDVPETAIFFIEDG+KVPA Sbjct: 153 DVQGDIAYDVVEFITDTWPDVPETAIFFIEDGRKVPA 189 >ref|XP_002309499.1| eukaryotic translation initiation factor SUI1 family protein [Populus trichocarpa] gi|222855475|gb|EEE93022.1| eukaryotic translation initiation factor SUI1 family protein [Populus trichocarpa] Length = 200 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDIAYDIVEFIT+TWPDVPETAIFFIEDGKKVPA Sbjct: 163 DVQGDIAYDIVEFITETWPDVPETAIFFIEDGKKVPA 199 >gb|EXB38850.1| Density-regulated-like protein [Morus notabilis] Length = 148 Score = 78.6 bits (192), Expect = 9e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDI YDIVEFITDTWPDVPETAIFFIEDGKKVPA Sbjct: 111 DVQGDIFYDIVEFITDTWPDVPETAIFFIEDGKKVPA 147 >ref|XP_004144004.1| PREDICTED: translation machinery-associated protein 22-like [Cucumis sativus] gi|449489890|ref|XP_004158450.1| PREDICTED: translation machinery-associated protein 22-like [Cucumis sativus] Length = 193 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDIAYDIV+FIT+TWPDVPETAIFFIEDGKKVPA Sbjct: 156 DVQGDIAYDIVDFITETWPDVPETAIFFIEDGKKVPA 192 >ref|XP_002324767.1| eukaryotic translation initiation factor SUI1 family protein [Populus trichocarpa] gi|222866201|gb|EEF03332.1| eukaryotic translation initiation factor SUI1 family protein [Populus trichocarpa] Length = 200 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDIAYDIVEFIT+TWPDVPETAI+FIEDGKKVPA Sbjct: 163 DVQGDIAYDIVEFITETWPDVPETAIYFIEDGKKVPA 199 >ref|XP_007202618.1| hypothetical protein PRUPE_ppa011888mg [Prunus persica] gi|462398149|gb|EMJ03817.1| hypothetical protein PRUPE_ppa011888mg [Prunus persica] Length = 192 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDIAYDIVEFITDTWPDVPE AIFFIEDG+KVPA Sbjct: 155 DVQGDIAYDIVEFITDTWPDVPEAAIFFIEDGRKVPA 191 >ref|NP_001235261.1| uncharacterized protein LOC100306708 [Glycine max] gi|255629337|gb|ACU15013.1| unknown [Glycine max] Length = 192 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDIAYDIVEFITDTWPDVPE AIFFIEDG+KVPA Sbjct: 155 DVQGDIAYDIVEFITDTWPDVPEAAIFFIEDGRKVPA 191 >ref|XP_004488049.1| PREDICTED: translation machinery-associated protein 22-like [Cicer arietinum] Length = 193 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDI+YDIVEFITDTWPDVPE AIFFIEDGKKVPA Sbjct: 156 DVQGDISYDIVEFITDTWPDVPEKAIFFIEDGKKVPA 192 >ref|XP_004968523.1| PREDICTED: translation machinery-associated protein 22-like isoform X2 [Setaria italica] Length = 202 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDI+YDIVEFITDTWPDVPE+AIFFIEDG+KVPA Sbjct: 165 DVQGDISYDIVEFITDTWPDVPESAIFFIEDGRKVPA 201 >tpg|DAA52988.1| TPA: hypothetical protein ZEAMMB73_597449 [Zea mays] Length = 170 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDI+YDIVEFITDTWPDVPE+AIFFIEDG+KVPA Sbjct: 133 DVQGDISYDIVEFITDTWPDVPESAIFFIEDGRKVPA 169 >tpg|DAA52987.1| TPA: hypothetical protein ZEAMMB73_597449 [Zea mays] Length = 192 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDI+YDIVEFITDTWPDVPE+AIFFIEDG+KVPA Sbjct: 155 DVQGDISYDIVEFITDTWPDVPESAIFFIEDGRKVPA 191 >gb|AFW80313.1| density-regulated protein [Zea mays] Length = 201 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDI+YDIVEFITDTWPDVPE+AIFFIEDG+KVPA Sbjct: 164 DVQGDISYDIVEFITDTWPDVPESAIFFIEDGRKVPA 200 >gb|AFK49317.1| unknown [Medicago truncatula] Length = 197 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 419 DVQGDIAYDIVEFITDTWPDVPETAIFFIEDGKKVPA 309 DVQGDI+YD+VEFITDTWPDVPE AIFFIEDGKKVPA Sbjct: 160 DVQGDISYDVVEFITDTWPDVPERAIFFIEDGKKVPA 196