BLASTX nr result
ID: Mentha24_contig00021650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00021650 (600 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530730.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 >ref|XP_002530730.1| conserved hypothetical protein [Ricinus communis] gi|223529694|gb|EEF31636.1| conserved hypothetical protein [Ricinus communis] Length = 322 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = +3 Query: 447 FGIDKIQKMLGSQLCVASLVMVILTASFNVVGPVSSSLAMMELPYVEKEV 596 FG+ IQK+LG Q+CVASLV+ L AS+ P+SSSLA ++LPYV E+ Sbjct: 165 FGLQDIQKVLGLQICVASLVVAALNASYGTSPPISSSLAEVDLPYVTYEI 214