BLASTX nr result
ID: Mentha24_contig00021616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00021616 (451 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42179.1| hypothetical protein MIMGU_mgv1a0200121mg, partia... 85 9e-15 >gb|EYU42179.1| hypothetical protein MIMGU_mgv1a0200121mg, partial [Mimulus guttatus] Length = 160 Score = 85.1 bits (209), Expect = 9e-15 Identities = 52/95 (54%), Positives = 59/95 (62%), Gaps = 1/95 (1%) Frame = -1 Query: 451 EPNAAQ-LYPQENSREERCFXXXXXXXXXGFVSRIRGYMDSTELTVFGARGLYATNRGNN 275 EPN A+ +YP+E R F GFVS IR YMDSTEL VF ARGL+ +R N Sbjct: 67 EPNVAEKIYPRE-----RNFRVGFSAGGGGFVSSIRSYMDSTELMVFAARGLFENHR-TN 120 Query: 274 ECLGRLRDVNNSPLKVWNEFWKSMYGNVQFPPNSV 170 ECLG + V SPLKVWN WKS+ GN FP NSV Sbjct: 121 ECLGSVDGV--SPLKVWNNIWKSVSGNDHFPLNSV 153