BLASTX nr result
ID: Mentha24_contig00021083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00021083 (559 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18181.1| hypothetical protein MIMGU_mgv1a006202mg [Mimulus... 51 1e-05 >gb|EYU18181.1| hypothetical protein MIMGU_mgv1a006202mg [Mimulus guttatus] Length = 453 Score = 51.2 bits (121), Expect(2) = 1e-05 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -2 Query: 234 RFTATVTVCGQVFETPAHCKSSKEAQNTAARVAFD 130 RFTA V V G FETP CKS+K+AQNTAAR+AF+ Sbjct: 32 RFTAVVNVNGHRFETPEPCKSAKDAQNTAARIAFN 66 Score = 23.9 bits (50), Expect(2) = 1e-05 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -3 Query: 329 MYKSKLQELCQR 294 M KSKLQE CQR Sbjct: 1 MNKSKLQEFCQR 12