BLASTX nr result
ID: Mentha24_contig00021074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00021074 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003530964.2| PREDICTED: protein sel-1 homolog 2-like [Gly... 57 2e-06 >ref|XP_003530964.2| PREDICTED: protein sel-1 homolog 2-like [Glycine max] Length = 757 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/43 (69%), Positives = 31/43 (72%) Frame = -3 Query: 341 TILTLFVCLLTVLYLRERQRRNAAVGDVPPHQQQRPGEQAAPL 213 TILTLFVCLLTVLYLRERQRR AAV Q RP E AP+ Sbjct: 715 TILTLFVCLLTVLYLRERQRRQAAVAAGEVAQPNRPNELGAPM 757