BLASTX nr result
ID: Mentha24_contig00020804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00020804 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19288.1| hypothetical protein MIMGU_mgv1a022146mg, partial... 91 2e-16 ref|XP_004245788.1| PREDICTED: E3 ubiquitin-protein ligase HOS1 ... 57 3e-06 gb|AEA11207.1| ubiquitin-protein ligase-like protein [Solanum ly... 57 3e-06 ref|XP_006359255.1| PREDICTED: E3 ubiquitin-protein ligase HOS1-... 56 4e-06 >gb|EYU19288.1| hypothetical protein MIMGU_mgv1a022146mg, partial [Mimulus guttatus] Length = 687 Score = 90.5 bits (223), Expect = 2e-16 Identities = 45/65 (69%), Positives = 53/65 (81%), Gaps = 1/65 (1%) Frame = -3 Query: 349 LTHWRKKLVEESVNLLPEVLQQQLKTGNLPEAAVFDGNQNIPPKSNL-PTVQEPILGNLL 173 ++HWRK LV +SV+LLP+VLQQQLK+GNLPE VF N+NI KSN TVQEPILGNLL Sbjct: 623 MSHWRKGLVGQSVDLLPDVLQQQLKSGNLPEVGVFPNNENISVKSNFGATVQEPILGNLL 682 Query: 172 FRAPQ 158 F AP+ Sbjct: 683 FNAPK 687 >ref|XP_004245788.1| PREDICTED: E3 ubiquitin-protein ligase HOS1 [Solanum lycopersicum] Length = 988 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -3 Query: 349 LTHWRKKLVEESVNLLPEVLQQQLKTGNLPEAAV-FDGNQNIPPKSNLPTVQEPILGNLL 173 + HWR LV++ V LLP++LQQQ++TG LPE V + NI +SN QEPI+ +LL Sbjct: 691 INHWRTCLVDKGVELLPDILQQQIRTGKLPELVVTCNDTVNISERSN-AVAQEPIMTSLL 749 Query: 172 FRAP 161 P Sbjct: 750 VNPP 753 >gb|AEA11207.1| ubiquitin-protein ligase-like protein [Solanum lycopersicum] Length = 496 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -3 Query: 349 LTHWRKKLVEESVNLLPEVLQQQLKTGNLPEAAV-FDGNQNIPPKSNLPTVQEPILGNLL 173 + HWR LV++ V LLP++LQQQ++TG LPE V + NI +SN QEPI+ +LL Sbjct: 199 INHWRTCLVDKGVELLPDILQQQIRTGKLPELVVTCNDTVNISERSN-AVAQEPIMTSLL 257 Query: 172 FRAP 161 P Sbjct: 258 VNPP 261 >ref|XP_006359255.1| PREDICTED: E3 ubiquitin-protein ligase HOS1-like [Solanum tuberosum] Length = 960 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -3 Query: 349 LTHWRKKLVEESVNLLPEVLQQQLKTGNLPEAAV-FDGNQNIPPKSNLPTVQEPILGNLL 173 + HWR LV++ V LLP+++QQQ++TG LPE V + NI +SN QEPI+ +LL Sbjct: 663 INHWRTCLVDKGVELLPDIIQQQIRTGKLPEVVVTCNDTVNISERSN-AVAQEPIMTSLL 721 Query: 172 FRAP 161 P Sbjct: 722 ANPP 725